• Gene id: 51266

Gene Summary

• Gene Symbol: CLEC1B   Gene   UCSC   Ensembl
• Aliases: 1810061I13Rik, CLEC2, CLEC2B, PRO1384, QDED721
• Gene name: C-type lectin domain family 1 member B
• Alternate names: C-type lectin domain family 1 member B, C-type lectin-like receptor 2, CLEC-2,
• Gene location: 12p13.31-p13.2 (10001893: 9986118)     Exons: 5     NC_000012.12
• Gene summary(Entrez): Natural killer (NK) cells express multiple calcium-dependent (C-type) lectin-like receptors, such as CD94 (KLRD1; MIM 602894) and NKG2D (KLRC4; MIM 602893), that interact with major histocompatibility complex class I molecules and either inhibit or activa
• OMIM: 606783

Protein Summary

• Protein general information: Q9P126  
  • Name: C type lectin domain family 1 member B (C type lectin like receptor 2) (CLEC 2)
  • Length: 229  
  • Mass: 26596
  • Tissue specificity: Expressed preferentially in the liver. Also expressed in immune cells of myeloid origin and on the surface of platelets. {ECO
• Sequence:

  MQDEDGYITLNIKTRKPALISVGSASSSWWRVMALILLILCVGMVVGLVALGIWSVMQRNYLQGENENRTGTLQQ
  LAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESKQYCTDMNATLLKIDNRNIVEYIK
  ARTHLIRWVGLSRQKSNEVWKWEDGSVISENMFEFLEDGKGNMNCAYFHNGKMHPTFCENKHYLMCERKAGMTKV
  DQLP

• Structural information:
  • Protein Domains: (109..21-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR016187  IPR033992  
  • Prosite: PS50041
  • CDD: cd03593
  • PDB: 2C6U 3WSR 3WWK
  • PDBsum: 2C6U 3WSR 3WWK
  • DIP: 61332
  • STRING: ENSP00000298527
• Other Databases: GeneCards:  CLEC1B  Malacards:  CLEC1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0023014	signal transduction by protein phosphorylation	IDA	biological process
GO:0004888	transmembrane signaling receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0006952	defense response	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0030220	platelet formation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04625	C-type lectin receptor signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)