• Gene id: 51264

Gene Summary

• Gene Symbol: MRPL27   Gene   UCSC   Ensembl
• Aliases: L27mt
• Gene name: mitochondrial ribosomal protein L27
• Alternate names: 39S ribosomal protein L27, mitochondrial, MRP-L27, mitochondrial large ribosomal subunit protein bL27m,
• Gene location: 17q21.33 (50373183: 50367866)     Exons: 4     NC_000017.11
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611837

Protein Summary

• Protein general information: Q9P0M9  
  • Name: 39S ribosomal protein L27, mitochondrial (L27mt) (MRP L27) (Mitochondrial large ribosomal subunit protein bL27m)
  • Length: 148  
  • Mass: 16073
• Sequence:

  MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRW
  HPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML

• Structural information:
  • Interpro: IPR001684  
  • PDB: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000225969
• Other Databases: GeneCards:  MRPL27  Malacards:  MRPL27

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005762	mitochondrial large ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0006412	translation	NAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)