• Gene id: 51258

Gene Summary

• Gene Symbol: MRPL51   Gene   UCSC   Ensembl
• Aliases: CDA09, HSPC241, MRP64, bMRP64
• Gene name: mitochondrial ribosomal protein L51
• Alternate names: 39S ribosomal protein L51, mitochondrial, L51mt, MRP-L51, bMRP-64, mitochondrial large ribosomal subunit protein mL51, mitochondrial ribosomal protein 64, mitochondrial ribosomal protein bMRP64,
• Gene location: 12p13.31 (6493261: 6491885)     Exons: 3     NC_000012.12
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611855

Protein Summary

• Protein general information: Q4U2R6  
  • Name: 39S ribosomal protein L51, mitochondrial (L51mt) (MRP L51) (Mitochondrial large ribosomal subunit protein mL51) (bMRP 64) (bMRP64)
  • Length: 128  
  • Mass: 15095
• Sequence:

  MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIR
  GPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR

• Structural information:
  • Interpro: IPR019373  
  • PDB: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000229238
• Other Databases: GeneCards:  MRPL51  Malacards:  MRPL51

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006412	translation	IBA	biological process
GO:0005762	mitochondrial large ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005761	mitochondrial ribosome	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005761	mitochondrial ribosome	IEA	cellular component
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	ISS	cellular component
GO:0003735	structural constituent of ribosome	ISS	molecular function
GO:0006412	translation	ISS	biological process
GO:0032543	mitochondrial translation	ISS	biological process
GO:0003735	structural constituent of ribosome	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881