• Gene id: 51241

Gene Summary

• Gene Symbol: COX16   Gene   UCSC   Ensembl
• Aliases: C14orf112, HSPC203, hCOX16
• Gene name: cytochrome c oxidase assembly factor COX16
• Alternate names: cytochrome c oxidase assembly protein COX16 homolog, mitochondrial, COX16, cytochrome c oxidase assembly homolog, cytochrome c oxidase assembly factor,
• Gene location: 14q24.2 (70359682: 70325080)     Exons: 4     NC_000014.9
• OMIM: 618064

Protein Summary

• Protein general information: Q9P0S2  
  • Name: Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (hCOX16)
  • Length: 106  
  • Mass: 12293
  • Tissue specificity: Widely expressed. Expressed at higher level in skeletal muscle, heart and liver. {ECO
• Sequence:

  MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKF
  DDWKNIRGPRPWEDPDLLQGRNPESLKTKTT

• Structural information:
  • Interpro: IPR020164  
  • STRING: ENSP00000374562
• Other Databases: GeneCards:  COX16  Malacards:  COX16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033617	mitochondrial cytochrome c oxidase assembly	IBA	biological process
GO:0031305	integral component of mitochondrial inner membrane	IBA	cellular component
GO:0031305	integral component of mitochondrial inner membrane	IDA	cellular component
GO:0031305	integral component of mitochondrial inner membrane	IDA	cellular component
GO:0033617	mitochondrial cytochrome c oxidase assembly	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0033617	mitochondrial cytochrome c oxidase assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003674	molecular_function	ND	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04714	Thermogenesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq