• Gene id: 51226

Gene Summary

• Gene Symbol: COPZ2   Gene   UCSC   Ensembl
• Aliases: zeta2-COP
• Gene name: COPI coat complex subunit zeta 2
• Alternate names: coatomer subunit zeta-2, coatomer protein complex subunit zeta 2, nonclathrin coat protein zeta-COP, zeta-2 COP, zeta-2-coat protein,
• Gene location: 17q21.32 (48048085: 48026166)     Exons: 11     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the adaptor complexes small subunit family. The encoded protein is a subunit of the coatomer protein complex, a seven-subunit complex that functions in the formation of COPI-type, non-clathrin-coated vesicles. COPI vesicles f

Protein Summary

• Protein general information: Q9P299  
  • Name: Coatomer subunit zeta 2 (Zeta 2 coat protein) (Zeta 2 COP)
  • Length: 210  
  • Mass: 23548
• Sequence:

  MQRPEAWPRPHPGEGAAAAQAGGPAPPARAGEPSGLRLQEPSLYTIKAVFILDNDGRRLLAKYYDDTFPSMKEQM
  VFEKNVFNKTSRTESEIAFFGGMTIVYKNSIDLFLYVVGSSYENELMLMSVLTCLFESLNHMLRKNVEKRWLLEN
  MDGAFLVLDEIVDGGVILESDPQQVIQKVNFRADDGGLTEQSVAQVLQSAKEQIKWSLLK

• Structural information:
  • Interpro: IPR022775  IPR039652  IPR011012  
  • STRING: ENSP00000480707
• Other Databases: GeneCards:  COPZ2  Malacards:  COPZ2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006891	intra-Golgi vesicle-mediated transport	IBA	biological process
GO:0030126	COPI vesicle coat	IBA	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IEA	biological process
GO:0030126	COPI vesicle coat	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0030126	COPI vesicle coat	IDA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0030663	COPI-coated vesicle membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006886	intracellular protein transport	NAS	biological process
GO:0005801	cis-Golgi network	NAS	cellular component
GO:0030126	COPI vesicle coat	NAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq