• Gene id: 51218

Gene Summary

• Gene Symbol: GLRX5   Gene   UCSC   Ensembl
• Aliases: C14orf87, FLB4739, GRX5, PR01238, PRO1238, PRSA, SIDBA3, SPAHGC
• Gene name: glutaredoxin 5
• Alternate names: glutaredoxin-related protein 5, mitochondrial, epididymis secretory sperm binding protein, glutaredoxin 5 homolog, monothiol glutaredoxin-5,
• Gene location: 14q32.13 (95535049: 95544713)     Exons: 2     NC_000014.9
• Gene summary(Entrez): This gene encodes a mitochondrial protein, which is evolutionarily conserved. It is involved in the biogenesis of iron-sulfur clusters, which are required for normal iron homeostasis. Mutations in this gene are associated with autosomal recessive pyridoxi
• OMIM: 609588

Protein Summary

• Protein general information: Q86SX6  
  • Name: Glutaredoxin related protein 5, mitochondrial (Monothiol glutaredoxin 5)
  • Length: 157  
  • Mass: 16628
• Sequence:

  MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQ
  ILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDE
  KKDQDSK

• Structural information:
  • Protein Domains: (42..14-)
    (/note="Glutaredoxin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00686"-)
  • Interpro: IPR002109  IPR033658  IPR014434  IPR004480  IPR036249  
  • Prosite: PS51354
  • CDD: cd03028
  • PDB: 2MMZ 2WUL
  • PDBsum: 2MMZ 2WUL
  • DIP: 50654
  • STRING: ENSP00000328570
• Other Databases: GeneCards:  GLRX5  Malacards:  GLRX5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005759	mitochondrial matrix	IBA	cellular component
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0030097	hemopoiesis	ISS	biological process
GO:0005739	mitochondrion	ISS	cellular component
GO:0009249	protein lipoylation	IMP	biological process
GO:0015035	protein disulfide oxidoreductase activity	IEA	molecular function
GO:0009055	electron transfer activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0044281	small molecule metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0022900	electron transport chain	IEA	biological process
GO:0005739	mitochondrion	ISS	cellular component

Diseases

Associated diseases	References
Sideroblastic anemia	KEGG:H00982
Sideroblastic anemia	KEGG:H00982
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq