• Gene id: 51209

Gene Summary

• Gene Symbol: RAB9B   Gene   UCSC   Ensembl
• Aliases: RAB9L, Rab-9L
• Gene name: RAB9B, member RAS oncogene family
• Alternate names: ras-related protein Rab-9B, Ras-associated protein 9B, Ras-associated protein RAB9-like,
• Gene location: Xq22.2 (103832281: 103776323)     Exons: 9     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of a subfamily of RAS small guanosine triphosphate (GTP)-binding proteins that regulate membrane trafficking. The encoded protein may be involved in endosome-to-Golgi transport. [provided by RefSeq, Jan 2010]
• OMIM: 608139

Protein Summary

• Protein general information: Q9NP90  
  • Name: Ras related protein Rab 9B (Rab 9 like protein) (Rab 9L)
  • Length: 201  
  • Mass: 22719
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTP
  FYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPY
  LETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC

• Structural information:
  • Interpro: IPR027417  IPR041824  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd04116
  • PDB: 2OCB
  • PDBsum: 2OCB
  • STRING: ENSP00000243298
• Other Databases: GeneCards:  RAB9B  Malacards:  RAB9B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0045335	phagocytic vesicle	IBA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005770	late endosome	IBA	cellular component
GO:0019003	GDP binding	IDA	molecular function
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0032482	Rab protein signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa05162	Measles

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray