• Gene id: 51208

Gene Summary

• Gene Symbol: CLDN18   Gene   UCSC   Ensembl
• Aliases: SFTA5, SFTPJ
• Gene name: claudin 18
• Alternate names: claudin-18, surfactant associated 5, surfactant associated protein J, surfactant, pulmonary associated protein J,
• Gene location: 3q22.3 (137998815: 138033648)     Exons: 6     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellula
• OMIM: 609210

Protein Summary

• Protein general information: P56856  
  • Name: Claudin 18
  • Length: 261  
  • Mass: 27856
  • Tissue specificity: Isoform A1
• Sequence:

  MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTECRPYFTILGLPAM
  LQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCAIAGVSVFANMLVTNFWMS
  TANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGF
  KASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV

• Structural information:
  • Interpro: IPR006187  IPR003928  IPR017974  IPR004031  
  • Prosite: PS01346
  • DIP: 48955
  • STRING: ENSP00000183605
• Other Databases: GeneCards:  CLDN18  Malacards:  CLDN18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005923	bicellular tight junction	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0070830	bicellular tight junction assembly	IBA	biological process
GO:0005198	structural molecule activity	IEA	molecular function
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045471	response to ethanol	IEA	biological process
GO:2001205	negative regulation of osteoclast development	IEA	biological process
GO:1900181	negative regulation of protein localization to nucleus	IEA	biological process
GO:0071847	TNFSF11-mediated signaling pathway	IEA	biological process
GO:0048565	digestive tract development	IEA	biological process
GO:0045779	negative regulation of bone resorption	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005923	bicellular tight junction	ISS	cellular component
GO:0042802	identical protein binding	ISS	molecular function
GO:0016338	calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05130	Pathogenic Escherichia coli infection
hsa04530	Tight junction
hsa04514	Cell adhesion molecules
hsa05160	Hepatitis C
hsa04670	Leukocyte transendothelial migration

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)