• Gene id: 51207

Gene Summary

• Gene Symbol: DUSP13   Gene   UCSC   Ensembl
• Aliases: BEDP, DUSP13A, DUSP13B, MDSP, SKRP4, TMDP
• Gene name: dual specificity phosphatase 13
• Alternate names: dual specificity protein phosphatase 13, branching-enzyme interacting DSP, branching-enzyme interacting dual-specificity protein phosphatase, muscle-restricted DSP, testis- and skeletal-muscle-specific DSP,
• Gene location: 10q22.2 (49094372: 49029706)     Exons: 13     NC_000003.12
• Gene summary(Entrez): Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the du
• OMIM: 613191

Protein Summary

• Protein general information: Q6B8I1  
  • Name: Dual specificity protein phosphatase 13 isoform A (DUSP13A) (EC 3.1.3.16) (EC 3.1.3.48) (Branching enzyme interacting DSP) (Muscle restricted DSP) (MDSP)
  • Length: 188  
  • Mass: 20658
  • Tissue specificity: Skeletal muscle specific. {ECO
• Sequence:

  MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGL
  YCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRL
  SLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS

• Structural information:
  • Protein Domains: (37..18-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR020417  IPR020405  IPR000340  IPR029021  IPR016130   IPR003595  IPR000387  IPR020422  
  • Prosite: PS00383 PS50056 PS50054
  • PDB: 5XJV
  • PDBsum: 5XJV
• Other Databases: GeneCards:  DUSP13  Malacards:  DUSP13
• Protein general information: Q9UII6  
  
  Name: Dual specificity protein phosphatase 13 isoform B (DUSP13B) (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity phosphatase SKRP4) (Testis and skeletal muscle specific DSP)
  
  Length: 198  Mass: 22149
  
  Tissue specificity: Most abundantly expressed in the testis. Also found in the skeletal muscle. Testis-specific (at protein level). {ECO
• Sequence: MDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHV
  VNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVL
  AFLMICENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF
• Structural information:

  Protein Domains	(114..18-) (/note="Tyrosine-protein-phosphatase")
  Interpro:	IPR020417  IPR020405  IPR000340  IPR029021  IPR016130   IPR000387  IPR020422
  Prosite:	PS00383 PS50056 PS50054
  PDB:	2GWO 2PQ5
  PDBsum:	2GWO 2PQ5
  STRING:	ENSP00000361785

• Other Databases: GeneCards:  DUSP13  Malacards:  DUSP13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016311	dephosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0016791	phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IDA	biological process
GO:0016791	phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	TAS	molecular function
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0051321	meiotic cell cycle	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray