• Gene id: 51206

Gene Summary

• Gene Symbol: GP6   Gene   UCSC   Ensembl
• Aliases: BDPLT11, GPIV, GPVI
• Gene name: glycoprotein VI platelet
• Alternate names: platelet glycoprotein VI, glycoprotein 6, platelet collagen receptor,
• Gene location: 19q13.42 (68213898: 68154862)     Exons: 13     NC_000011.10
• Gene summary(Entrez): This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a com
• OMIM: 605546

Protein Summary

• Protein general information: Q9HCN6  
  • Name: Platelet glycoprotein VI (GPVI) (Glycoprotein 6)
  • Length: 339  
  • Mass: 36866
  • Tissue specificity: Megakaryocytes and platelets. {ECO
• Sequence:

  MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFI
  PAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGD
  PAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSE
  ATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRH
  RGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS

• Structural information:
  • Protein Domains: (26..10-)
    1 (/note="Ig-like-C2-type)
    (114..19-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598  
  • PDB: 2GI7 5OU7 5OU8 5OU9
  • PDBsum: 2GI7 5OU7 5OU8 5OU9
  • DIP: 33875
  • STRING: ENSP00000308782
• Other Databases: GeneCards:  GP6  Malacards:  GP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007596	blood coagulation	IEA	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005518	collagen binding	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007167	enzyme linked receptor protein signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0097197	tetraspanin-enriched microdomain	IDA	cellular component
GO:0030168	platelet activation	NAS	biological process
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0009986	cell surface	HDA	cellular component
GO:0005518	collagen binding	TAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04611	Platelet activation
hsa04512	ECM-receptor interaction

Diseases

Associated diseases	References
Bleeding disorder platelet-type	KEGG:H01235
Bleeding disorder platelet-type	KEGG:H01235
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq