• Gene id: 51204

Gene Summary

• Gene Symbol: TACO1   Gene   UCSC   Ensembl
• Aliases: CCDC44
• Gene name: translational activator of cytochrome c oxidase I
• Alternate names: translational activator of cytochrome c oxidase 1, clone HQ0477 PRO0477p, coiled-coil domain-containing protein 44, translational activator of COX I, translational activator of mitochondrially encoded cytochrome c oxidase I,
• Gene location: 17q23.3 (2702693: 2511218)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a mitochondrial protein that function as a translational activator of mitochondrially-encoded cytochrome c oxidase 1. Mutations in this gene are associated with Leigh syndrome.[provided by RefSeq, Mar 2010]
• OMIM: 612958

Protein Summary

• Protein general information: Q9BSH4  
  • Name: Translational activator of cytochrome c oxidase 1 (Coiled coil domain containing protein 44) (Translational activator of mitochondrially encoded cytochrome c oxidase I)
  • Length: 297  
  • Mass: 32477
• Sequence:

  MSAWAAASLSRAAARCLLARGPGVRAAPPRDPRPSHPEPRGCGAAPGRTLHFTAAVPAGHNKWSKVRHIKGPKDV
  ERSRIFSKLCLNIRLAVKEGGPNPEHNSNLANILEVCRSKHMPKSTIETALKMEKSKDTYLLYEGRGPGGSSLLI
  EALSNSSHKCQADIRHILNKNGGVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMAIEAGAEDVKETEDEE
  ERNVFKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLIQALSNHEDVIHVYDNIE

• Structural information:
  • Interpro: IPR017856  IPR002876  IPR026564  IPR029072  
  • STRING: ENSP00000258975
• Other Databases: GeneCards:  TACO1  Malacards:  TACO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070129	regulation of mitochondrial translation	IEA	biological process
GO:0061743	motor learning	IEA	biological process
GO:0033617	mitochondrial cytochrome c oxidase assembly	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:1904959	regulation of cytochrome-c oxidase activity	IEA	biological process
GO:0097177	mitochondrial ribosome binding	IEA	molecular function
GO:0019843	rRNA binding	IEA	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Leigh syndrome	KEGG:H01354
Leigh syndrome	KEGG:H01354
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq