• Gene id: 51203

Gene Summary

• Gene Symbol: NUSAP1   Gene   UCSC   Ensembl
• Aliases: ANKT, BM037, LNP, NUSAP, PRO0310p1, Q0310, SAPL
• Gene name: nucleolar and spindle associated protein 1
• Alternate names: nucleolar and spindle-associated protein 1, nucleolar protein ANKT,
• Gene location: 15q15.1 (13574216: 13615157)     Exons: 17     NC_000006.12
• Gene summary(Entrez): NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 [PubMed 12963707]).[supplied by OMIM, Jun 2009]
• OMIM: 612818

Protein Summary

• Protein general information: Q9BXS6  
  • Name: Nucleolar and spindle associated protein 1 (NuSAP)
  • Length: 441  
  • Mass: 49452
• Sequence:

  MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTSASSCDETEIQISNQE
  EAERQPLGHVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHEKQESQDLRATAKVPSPPDEHQEAENAVSSG
  NRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAHFKEMESIDQYIERKKKHFEEHNSMNELKQQPIN
  KGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKT
  PARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKG
  KLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGLILAED

• Structural information:
  • Interpro: IPR026756  
  • STRING: ENSP00000453403
• Other Databases: GeneCards:  NUSAP1  Malacards:  NUSAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0040001	establishment of mitotic spindle localization	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0007076	mitotic chromosome condensation	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0072686	mitotic spindle	IBA	cellular component
GO:0005876	spindle microtubule	IBA	colocalizes with
GO:0000281	mitotic cytokinesis	IBA	biological process
GO:0040001	establishment of mitotic spindle localization	IEA	biological process
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0000281	mitotic cytokinesis	IEA	biological process
GO:0005819	spindle	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0040001	establishment of mitotic spindle localization	IDA	biological process
GO:0007076	mitotic chromosome condensation	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0000281	mitotic cytokinesis	IDA	biological process
GO:0000070	mitotic sister chromatid segregation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)