• Gene id: 51201

Gene Summary

• Gene Symbol: ZDHHC2   Gene   UCSC   Ensembl
• Aliases: DHHC2, ZNF372
• Gene name: zinc finger DHHC-type palmitoyltransferase 2
• Alternate names: palmitoyltransferase ZDHHC2, DHHC-2, ream, rec, reduced expression associated with metastasis protein, reduced expression in cancer protein, testis tissue sperm-binding protein Li 56e, zinc finger DHHC domain-containing protein 2, zinc finger DHHC-type containing,
• Gene location: 8p22 (17155999: 17230705)     Exons: 17     NC_000008.11
• OMIM: 618621

Protein Summary

• Protein general information: Q9UIJ5  
  • Name: Palmitoyltransferase ZDHHC2 (EC 2.3.1.225) (Reduced expression associated with metastasis protein) (Ream) (Reduced expression in cancer protein) (Rec) (Zinc finger DHHC domain containing protein 2) (DHHC 2) (Zinc finger protein 372)
  • Length: 367  
  • Mass: 42022
  • Tissue specificity: Ubiquitously expressed. Reduced expression in colorectal cancers with liver metastasis. {ECO
• Sequence:

  MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYHLLFAMFVWSYWKTIF
  TLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLIKPDRCHHCSVCDKCI
  LKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLFIAATDLQYFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSL
  SSLFGYHCWLVSKNKSTLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQ
  DPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPGKCKAGMSNPALTMENET

• Structural information:
  • Protein Domains: (127..17-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000262096
• Other Databases: GeneCards:  ZDHHC2  Malacards:  ZDHHC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IDA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IDA	biological process
GO:0022407	regulation of cell-cell adhesion	IMP	biological process
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IMP	biological process
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IMP	biological process
GO:0042176	regulation of protein catabolic process	IMP	biological process
GO:1905751	positive regulation of endosome to plasma membrane protein transport	ISS	biological process
GO:1904719	positive regulation of AMPA glutamate receptor clustering	ISS	biological process
GO:0072659	protein localization to plasma membrane	ISS	biological process
GO:0048168	regulation of neuronal synaptic plasticity	ISS	biological process
GO:0098837	postsynaptic recycling endosome	ISS	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IMP	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:1903539	protein localization to postsynaptic membrane	ISS	biological process
GO:1900273	positive regulation of long-term synaptic potentiation	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:1903076	regulation of protein localization to plasma membrane	IMP	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0016409	palmitoyltransferase activity	TAS	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0018345	protein palmitoylation	IEA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R