• Gene id: 51192

Gene Summary

• Gene Symbol: CKLF   Gene   UCSC   Ensembl
• Aliases: C32, CKLF1, CKLF2, CKLF3, CKLF4, HSPC224, UCK-1
• Gene name: chemokine like factor
• Alternate names: chemokine-like factor, chemokine-like factor 1, chemokine-like factor 2, chemokine-like factor 3, chemokine-like factor 4, transmembrane proteolipid,
• Gene location: 16q21 (66552562: 66566286)     Exons: 5     NC_000016.10
• Gene summary(Entrez): The product of this gene is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. The protein encoded b
• OMIM: 616074

Protein Summary

• Protein general information: Q9UBR5  
  • Name: Chemokine like factor (C32)
  • Length: 152  
  • Mass: 17170
  • Tissue specificity: Isoform 1, isoform 2, isoform 3 and isoform 4 have highest expression levels in adult spleen, lung, testis, ovary, peripheral blood leukocyte, placenta, pancreas, and in fetal brain, skeletal muscle, thymus and heart. Lower expression
• Sequence:

  MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFILLYVLRLDRLMKWLF
  WPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVCCLADGALIYRKLLFNPSGPYQKKPVHEKKE
  VL

• Structural information:
  • Protein Domains: (13..13-)
    (/note="MARVEL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
  • Interpro: IPR008253  
  • Prosite: PS51225
  • STRING: ENSP00000264001
• Other Databases: GeneCards:  CKLF  Malacards:  CKLF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0030595	leukocyte chemotaxis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0048246	macrophage chemotaxis	IDA	biological process
GO:0030593	neutrophil chemotaxis	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0048247	lymphocyte chemotaxis	IDA	biological process
GO:0032940	secretion by cell	IDA	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq