• Gene id: 51188

Gene Summary

• Gene Symbol: SS18L2   Gene   UCSC   Ensembl
• Aliases: KIAA-iso
• Gene name: SS18 like 2
• Alternate names: SS18-like protein 2, SYT homolog 2, synovial sarcoma translocation gene on chromosome 18-like 2,
• Gene location: 3p22.1 (42581839: 42596933)     Exons: 4     NC_000003.12
• Gene summary(Entrez): Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame
• OMIM: 300031

Protein Summary

• Protein general information: Q9UHA2  
  • Name: SS18 like protein 2 (SYT homolog 2)
  • Length: 77  
  • Mass: 8835
• Sequence:

  MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPTSTSKA
  ME

• Structural information:
  • Interpro: IPR007726  
  • STRING: ENSP00000401115
• Other Databases: GeneCards:  SS18L2  Malacards:  SS18L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050775	positive regulation of dendrite morphogenesis	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881