• Gene id: 51187

Gene Summary

• Gene Symbol: RSL24D1   Gene   UCSC   Ensembl
• Aliases: C15orf15, HRP-L30-iso, L30, RLP24, RPL24, RPL24L, TVAS3
• Gene name: ribosomal L24 domain containing 1
• Alternate names: probable ribosome biogenesis protein RLP24, 60S ribosomal protein L30 isolog, homolog of yeast ribosomal like protein 24, my024 protein, ribosomal L24 domain-containing protein 1,
• Gene location: 15q21.3 (55196940: 55180805)     Exons: 6     NC_000015.10
• Gene summary(Entrez): This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human g
• OMIM: 613262

Protein Summary

• Protein general information: Q9UHA3  
  • Name: Probable ribosome biogenesis protein RLP24 (Ribosomal L24 domain containing protein 1) (Ribosomal protein L24 like)
  • Length: 163  
  • Mass: 19621
• Sequence:

  MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRR
  NEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMV
  QQLQEDVDMEDAP

• Structural information:
  • Interpro: IPR038630  IPR023438  IPR000988  IPR023442  IPR011017  
  • Prosite: PS01073
  • CDD: cd00472
  • STRING: ENSP00000260443
• Other Databases: GeneCards:  RSL24D1  Malacards:  RSL24D1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902626	assembly of large subunit precursor of preribosome	IBA	biological process
GO:0022625	cytosolic large ribosomal subunit	IBA	cellular component
GO:0006412	translation	IBA	biological process
GO:0000027	ribosomal large subunit assembly	IBA	biological process
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)