• Gene id: 51186

Gene Summary

• Gene Symbol: TCEAL9   Gene   UCSC   Ensembl
• Aliases: WBP5, WEX6
• Gene name: transcription elongation factor A like 9
• Alternate names: transcription elongation factor A protein-like 9, TCEA-like protein 9, WBP-5, WW domain binding protein 1, WW domain-binding protein 5, pp21 homolog, transcription elongation factor S-II protein-like 9,
• Gene location: Xq22.2 (103356505: 103358461)     Exons: 3     NC_000023.11
• Gene summary(Entrez): The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding
• OMIM: 0

Protein Summary

• Protein general information: Q9UHQ7  
  • Name: Transcription elongation factor A protein like 9 (TCEA like protein 9) (Transcription elongation factor S II protein like 9) (WW domain binding protein 5) (WBP 5)
  • Length: 104  
  • Mass: 12749
• Sequence:

  MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVD
  EIDEIRRVRNKLIVMRWKVNRNHPYPYLM

• Structural information:
  • Interpro: IPR021156  
  • STRING: ENSP00000361745
• Other Databases: GeneCards:  TCEAL9  Malacards:  TCEAL9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0050699	WW domain binding	IBA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881