• Gene id: 51182

Gene Summary

• Gene Symbol: HSPA14   Gene   UCSC   Ensembl
• Aliases: HSP70-4, HSP70L1
• Gene name: heat shock protein family A (Hsp70) member 14
• Alternate names: heat shock 70 kDa protein 14, HSP70-like protein 1, heat shock 70kDa protein 14 isoform 1 variant 3, heat shock protein HSP60, heat shock protein hsp70-related protein,
• Gene location: 10p13 (14838159: 14871740)     Exons: 16     NC_000010.11
• OMIM: 610369

Protein Summary

• Protein general information: Q0VDF9  
  • Name: Heat shock 70 kDa protein 14 (HSP70 like protein 1) (Heat shock protein HSP60)
  • Length: 509  
  • Mass: 54794
• Sequence:

  MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQILGRSS
  SDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVVITVPFDFGEK
  QKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDN
  IGGAHFTETLAQYLASEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANCFLDSLYEGQDFDCNVSRARF
  ELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKDLFPAVELLNSIPPDEVIPIGAAIEA
  GILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGTPLPARRQHTLQAPGSISSVCLELYESDGKN
  SAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHVTCTDQETGKCEAISIEIAS

• Structural information:
  • Interpro: IPR018181  IPR029047  IPR013126  IPR042049  
  • Prosite: PS01036
  • CDD: cd10238
  • DIP: 62114
  • STRING: ENSP00000367623
• Other Databases: GeneCards:  HSPA14  Malacards:  HSPA14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002181	cytoplasmic translation	IBA	biological process
GO:0005840	ribosome	IBA	colocalizes with
GO:0006450	regulation of translational fidelity	IBA	biological process
GO:0006986	response to unfolded protein	IBA	biological process
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0051085	chaperone cofactor-dependent protein refolding	IBA	biological process
GO:0051787	misfolded protein binding	IBA	molecular function
GO:0005524	ATP binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005844	polysome	IBA	cellular component
GO:0016887	ATPase activity	IBA	molecular function
GO:0031072	heat shock protein binding	IBA	molecular function
GO:0034620	cellular response to unfolded protein	IBA	biological process
GO:0042026	protein refolding	IBA	biological process
GO:0044183	protein folding chaperone	IBA	molecular function
GO:0005840	ribosome	IDA	colocalizes with
GO:0005829	cytosol	IDA	cellular component
GO:0051083	'de novo' cotranslational protein folding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray