• Gene id: 51181

Gene Summary

• Gene Symbol: DCXR   Gene   UCSC   Ensembl
• Aliases: DCR, HCR2, HCRII, KIDCR, P34H, PNTSU, SDR20C1, XR
• Gene name: dicarbonyl and L-xylulose reductase
• Alternate names: L-xylulose reductase, carbonyl reductase 2, carbonyl reductase II, dicarbonyl/L-xylulose reductase, kidney dicarbonyl reductase, short chain dehydrogenase/reductase family 20C member 1, sperm surface protein P34H,
• Gene location: 17q25.3 (82037696: 82035880)     Exons: 8     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene acts as a homotetramer to catalyze diacetyl reductase and L-xylulose reductase reactions. The encoded protein may play a role in the uronate cycle of glucose metabolism and in the cellular osmoregulation in the proximal re
• OMIM: 608347

Protein Summary

• Protein general information: Q7Z4W1  
  • Name: L xylulose reductase (XR) (EC 1.1.1.10) (Carbonyl reductase II) (Dicarbonyl/L xylulose reductase) (Kidney dicarbonyl reductase) (kiDCR) (Short chain dehydrogenase/reductase family 20C member 1) (Sperm surface protein P34H)
  • Length: 244  
  • Mass: 25,913
• Sequence:

  MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERALGSVG
  PVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQRAVTNHSVYC
  STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSD
  RSGMTTGSTLPVEGGFWAC

• Structural information:
  • Interpro: IPR036291  IPR020904  IPR002347  
  • Prosite: PS00061
  • PDB: 1PR9 1WNT 3D3W
  • PDBsum: 1PR9 1WNT 3D3W
  • STRING: ENSP00000303356
• Other Databases: GeneCards:  DCXR  Malacards:  DCXR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0005997	xylulose metabolic process	IDA	biological process
GO:0006006	glucose metabolic process	IDA	biological process
GO:0006739	NADP metabolic process	IEA	biological process
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	molecular function
GO:0019640	glucuronate catabolic process to xylulose 5-phosphate	TAS	biological process
GO:0042732	D-xylose metabolic process	IEA	biological process
GO:0050038	L-xylulose reductase (NADP+) activity	EXP	molecular function
GO:0050038	L-xylulose reductase (NADP+) activity	IDA	molecular function
GO:0051289	protein homotetramerization	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005997	xylulose metabolic process	IEA	biological process
GO:0005997	xylulose metabolic process	IDA	biological process
GO:0006006	glucose metabolic process	IEA	biological process
GO:0006006	glucose metabolic process	IEA	biological process
GO:0006006	glucose metabolic process	IDA	biological process
GO:0006739	NADP metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016614	oxidoreductase activity, acting on CH-OH group of donors	IEA	molecular function
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	molecular function
GO:0019640	glucuronate catabolic process to xylulose 5-phosphate	TAS	biological process
GO:0042732	D-xylose metabolic process	IEA	biological process
GO:0050038	L-xylulose reductase (NADP+) activity	IEA	molecular function
GO:0050038	L-xylulose reductase (NADP+) activity	IEA	molecular function
GO:0050038	L-xylulose reductase (NADP+) activity	EXP	molecular function
GO:0050038	L-xylulose reductase (NADP+) activity	IDA	molecular function
GO:0051289	protein homotetramerization	IEA	biological process
GO:0051289	protein homotetramerization	IDA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005997	xylulose metabolic process	IDA	biological process
GO:0006006	glucose metabolic process	IDA	biological process
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	IDA	molecular function
GO:0019640	glucuronate catabolic process to xylulose 5-phosphate	TAS	biological process
GO:0050038	L-xylulose reductase (NADP+) activity	EXP	molecular function
GO:0050038	L-xylulose reductase (NADP+) activity	IDA	molecular function
GO:0051289	protein homotetramerization	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways

Diseases

Associated diseases	References
Male factor infertility	MIK: 8722621
Male factor infertility	MIK: 17434498
Pentosuria	KEGG: H01065
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Idiopathic infertility	MIK: 8722621
Idiopathic infertility in IVF	MIK: 24882558
Involved in sperm-zone pellucida interaction	MIK: 8722620
Male infertility	MIK: 17434498
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17434498	Male infertility				Male infertility	P34H
8722621	Idiopathic infertility			16 men with idiopathic infertility	Male infertility	P34H
8722620	Involved in sperm-zone pellucida interaction				Male infertility
24882558	Idiopathic infertility in IVF				Male infertility	RXRA DCXR
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881