• Gene id: 5118

Gene Summary

• Gene Symbol: PCOLCE   Gene   UCSC   Ensembl
• Aliases: PCPE, PCPE-1, PCPE1
• Gene name: procollagen C-endopeptidase enhancer
• Alternate names: procollagen C-endopeptidase enhancer 1, procollagen C-proteinase enhancer 1, procollagen COOH-terminal proteinase enhancer 1, procollagen, type 1, COOH-terminal proteinase enhancer, type 1 procollagen C-proteinase enhancer protein, type I procollagen COOH-term,
• Gene location: 7q22.1 (100602362: 100608174)     Exons: 10     NC_000007.14
• Gene summary(Entrez): Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procoll
• OMIM: 607290

Protein Summary

• Protein general information: Q15113  
  • Name: Procollagen C endopeptidase enhancer 1 (Procollagen COOH terminal proteinase enhancer 1) (PCPE 1) (Procollagen C proteinase enhancer 1) (Type 1 procollagen C proteinase enhancer protein) (Type I procollagen COOH terminal proteinase enhancer)
  • Length: 449  
  • Mass: 47972
• Sequence:

  MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVASEGFPNLYPPNKECIWTITVPEGQTV
  SLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPLVAPGNQVTLRMTTDEGTGGRGFLLWYSGRA
  TSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIALTFEKFDLEPDTYCRYDSVSVFNGAV
  SDDSRRLGKFCGDAVPGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS
  QPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPP
  TGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTNLSKRKCPSQPVRAAASQD

• Structural information:
  • Protein Domains: (37..14-)
    (/note="CUB-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (159..27-)
    (/note="CUB-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (318..43-)
    (/note="NTR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00295"-)
  • Interpro: IPR000859  IPR001134  IPR018933  IPR035814  IPR028870   IPR035914  IPR008993  
  • Prosite: PS01180 PS50189
  • CDD: cd00041 cd03576
  • PDB: 1UAP 6FZV 6FZW
  • PDBsum: 1UAP 6FZV 6FZW
  • STRING: ENSP00000223061
• Other Databases: GeneCards:  PCOLCE  Malacards:  PCOLCE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IEA	cellular component
GO:0016504	peptidase activator activity	IEA	molecular function
GO:0005518	collagen binding	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	TAS	biological process
GO:0016504	peptidase activator activity	IDA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0005518	collagen binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0010952	positive regulation of peptidase activity	IEA	biological process
GO:0010952	positive regulation of peptidase activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq