• Gene id: 51177

Gene Summary

• Gene Symbol: PLEKHO1   Gene   UCSC   Ensembl
• Aliases: CKIP-1, CKIP1, JBP, OC120
• Gene name: pleckstrin homology domain containing O1
• Alternate names: pleckstrin homology domain-containing family O member 1, C-Jun-binding protein, CK2 interacting protein 1; HQ0024c protein, CK2-interacting protein 1, PH domain-containing family O member 1, casein kinase 2-interacting protein 1, osteoclast maturation-associate,
• Gene location: 1q21.2 (150149433: 150160064)     Exons: 7     NC_000001.11
• OMIM: 0

Protein Summary

• Protein general information: Q53GL0  
  • Name: Pleckstrin homology domain containing family O member 1 (PH domain containing family O member 1) (C Jun binding protein) (JBP) (Casein kinase 2 interacting protein 1) (CK2 interacting protein 1) (CKIP 1) (Osteoclast maturation associated gene 120 protein)
  • Length: 409  
  • Mass: 46237
  • Tissue specificity: Abundantly expressed in skeletal muscle and heart, moderately in kidney, liver, brain and placenta and sparingly in the pancreas and lung. Easily detectable in cell lines such as MOLT-4, HEK293 and Jurkat. {ECO
• Sequence:

  MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDY
  EKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVTVEEDSYL
  AHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVDLDKSVAQLAGSRRRA
  DSDRIQPSADRASSLSRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRDAASARTLQLRAEEPPTPALP
  NPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQLLLETERLLGEASSNWSQAKRVLQE
  VRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM

• Structural information:
  • Protein Domains: (21..13-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR028452  IPR011993  IPR001849  
  • Prosite: PS50003
  • PDB: 3AA1
  • PDBsum: 3AA1
  • DIP: 46903
  • STRING: ENSP00000358120
• Other Databases: GeneCards:  PLEKHO1  Malacards:  PLEKHO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008360	regulation of cell shape	IEA	biological process
GO:0032587	ruffle membrane	IEA	cellular component
GO:0036195	muscle cell projection membrane	IEA	cellular component
GO:0007520	myoblast fusion	IEA	biological process
GO:0051451	myoblast migration	IEA	biological process
GO:0072673	lamellipodium morphogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R