• Gene id: 51176

Gene Summary

• Gene Symbol: LEF1   Gene   UCSC   Ensembl
• Aliases: LEF-1, TCF10, TCF1ALPHA, TCF7L3
• Gene name: lymphoid enhancer binding factor 1
• Alternate names: lymphoid enhancer-binding factor 1, T cell-specific transcription factor 1-alpha, TCF1-alpha,
• Gene location: 4q25 (108168955: 108047544)     Exons: 13     NC_000004.12
• Gene summary(Entrez): This gene encodes a transcription factor belonging to a family of proteins that share homology with the high mobility group protein-1. The protein encoded by this gene can bind to a functionally important site in the T-cell receptor-alpha enhancer, thereb
• OMIM: 153245

Protein Summary

• Protein general information: Q9UJU2  
  • Name: Lymphoid enhancer binding factor 1 (LEF 1) (T cell specific transcription factor 1 alpha) (TCF1 alpha)
  • Length: 399  
  • Mass: 44201
  • Tissue specificity: Detected in thymus. Not detected in normal colon, but highly expressed in colon cancer biopsies and colon cancer cell lines. Expressed in several pancreatic tumors and weakly expressed in normal pancreatic tissue. Isoforms 1 and 5 are
• Sequence:

  MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQ
  AQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHA
  VHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGF
  RQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
  KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKK
  KKRKREKLQESASGTGPRMTAAYI

• Structural information:
  • Interpro: IPR027397  IPR013558  IPR009071  IPR036910  IPR028769   IPR024940  
  • Prosite: PS50118
  • DIP: 29946
  • STRING: ENSP00000265165
• Other Databases: GeneCards:  LEF1  Malacards:  LEF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990907	beta-catenin-TCF complex	IPI	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0003682	chromatin binding	IBA	molecular function
GO:0008013	beta-catenin binding	IBA	molecular function
GO:0016055	Wnt signaling pathway	IBA	biological process
GO:0022407	regulation of cell-cell adhesion	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0070016	armadillo repeat domain binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0030331	estrogen receptor binding	IBA	molecular function
GO:0045295	gamma-catenin binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0008013	beta-catenin binding	TAS	molecular function
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902262	apoptotic process involved in blood vessel morphogenesis	IEA	biological process
GO:0061153	trachea gland development	IEA	biological process
GO:0060561	apoptotic process involved in morphogenesis	IEA	biological process
GO:0060325	face morphogenesis	IEA	biological process
GO:0050909	sensory perception of taste	IEA	biological process
GO:0048341	paraxial mesoderm formation	IEA	biological process
GO:0046632	alpha-beta T cell differentiation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0033153	T cell receptor V(D)J recombination	IEA	biological process
GO:0030326	embryonic limb morphogenesis	IEA	biological process
GO:0022407	regulation of cell-cell adhesion	IEA	biological process
GO:0021873	forebrain neuroblast division	IEA	biological process
GO:0021861	forebrain radial glial cell differentiation	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0021542	dentate gyrus development	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0001944	vasculature development	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0062009	secondary palate development	IEA	biological process
GO:0060710	chorio-allantoic fusion	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0060033	anatomical structure regression	IEA	biological process
GO:0048468	cell development	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045843	negative regulation of striated muscle tissue development	IEA	biological process
GO:0045588	positive regulation of gamma-delta T cell differentiation	IEA	biological process
GO:0045063	T-helper 1 cell differentiation	IEA	biological process
GO:0043586	tongue development	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0042100	B cell proliferation	IEA	biological process
GO:0030879	mammary gland development	IEA	biological process
GO:0030509	BMP signaling pathway	IEA	biological process
GO:0030111	regulation of Wnt signaling pathway	IEA	biological process
GO:0021943	formation of radial glial scaffolds	IEA	biological process
GO:0008301	DNA binding, bending	IEA	molecular function
GO:0008134	transcription factor binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001837	epithelial to mesenchymal transition	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0001569	branching involved in blood vessel morphogenesis	IEA	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0070016	armadillo repeat domain binding	IPI	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045295	gamma-catenin binding	IPI	molecular function
GO:0032993	protein-DNA complex	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0001837	epithelial to mesenchymal transition	ISS	biological process
GO:0030854	positive regulation of granulocyte differentiation	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0062009	secondary palate development	ISS	biological process
GO:0071345	cellular response to cytokine stimulus	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0032713	negative regulation of interleukin-4 production	IDA	biological process
GO:0071899	negative regulation of estrogen receptor binding	IDA	biological process
GO:0071353	cellular response to interleukin-4	IDA	biological process
GO:0060326	cell chemotaxis	IDA	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0032714	negative regulation of interleukin-5 production	IDA	biological process
GO:0030854	positive regulation of granulocyte differentiation	IDA	biological process
GO:0030331	estrogen receptor binding	IDA	molecular function
GO:0030284	estrogen receptor activity	IDA	molecular function
GO:0005634	nucleus	IC	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0043923	positive regulation by host of viral transcription	IDA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0043392	negative regulation of DNA binding	IDA	biological process
GO:0032696	negative regulation of interleukin-13 production	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071866	negative regulation of apoptotic process in bone marrow cell	IMP	biological process
GO:0045063	T-helper 1 cell differentiation	ISS	biological process
GO:0043967	histone H4 acetylation	IMP	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IMP	molecular function
GO:0010718	positive regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	ISS	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0001649	osteoblast differentiation	IEP	biological process
GO:0070742	C2H2 zinc finger domain binding	IPI	molecular function
GO:0043966	histone H3 acetylation	IMP	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0030307	positive regulation of cell growth	IMP	biological process
GO:0030223	neutrophil differentiation	IMP	biological process
GO:0008301	DNA binding, bending	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071864	positive regulation of cell proliferation in bone marrow	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0042393	histone binding	IPI	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0045588	positive regulation of gamma-delta T cell differentiation	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05132	Salmonella infection
hsa04310	Wnt signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa05210	Colorectal cancer
hsa05215	Prostate cancer
hsa05217	Basal cell carcinoma
hsa04520	Adherens junction
hsa05221	Acute myeloid leukemia
hsa05213	Endometrial cancer
hsa05216	Thyroid cancer

Diseases

Associated diseases	References
Prostate cancer	PMID:27067790
Ovarian cancer	PMID:14520463
thyroid gland papillary carcinoma	PMID:28677753
prostate carcinoma in situ	PMID:27067790
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray