Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 51170
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol HSD17B11   Gene   UCSC   Ensembl
Aliases 17-BETA-HSD11, 17-BETA-HSDXI, 17BHSD11, DHRS8, PAN1B, RETSDR2, SDR16C2
Gene name hydroxysteroid 17-beta dehydrogenase 11
Alternate names estradiol 17-beta-dehydrogenase 11, 17-beta-hydroxysteroid dehydrogenase type XI, CTCL tumor antigen HD-CL-03, CTCL-associated antigen HD-CL-03, cutaneous T-cell lymphoma-associated antigen HD-CL-03, dehydrogenase/reductase SDR family member 8, retinal short-ch,
Gene location 4q22.1 (87391251: 87336514)     Exons: 8     NC_000004.12
Gene summary(Entrez) Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).[supplied by OMIM, Jun 2009]
OMIM 614574

Protein Summary
Protein general information Q8NBQ5  

Name: Estradiol 17 beta dehydrogenase 11 (EC 1.1.1.62) (17 beta hydroxysteroid dehydrogenase 11) (17 beta HSD 11) (17bHSD11) (17betaHSD11) (17 beta hydroxysteroid dehydrogenase XI) (17 beta HSD XI) (17betaHSDXI) (Cutaneous T cell lymphoma associated antigen HD

Length: 300  Mass: 32936

Tissue specificity: Present at high level in steroidogenic cells such as syncytiotrophoblasts, sebaceous gland, Leydig cells, and granulosa cells of the dominant follicle and corpus luteum. In lung, it is detected in the ciliated epithelium and in acini o

Sequence MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEE
TAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFW
TTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGF
IKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ
Structural information
Interpro:  IPR036291  IPR002347  

PDB:  		 1YB1
PDBsum:   1YB1
MINT:  
STRING:   ENSP00000351035
Other Databases GeneCards:  HSD17B11  Malacards:  HSD17B11

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0006710 androgen catabolic proces
s
 IDA biological process
GO:0016229 steroid dehydrogenase act
ivity
 IDA molecular function
GO:0005737 cytoplasm
 IDA cellular component
GO:0016229 steroid dehydrogenase act
ivity
 IBA molecular function
GO:0005811 lipid droplet
 IBA cellular component
GO:0016616 oxidoreductase activity,
acting on the CH-OH group
of donors, NAD or NADP a
s acceptor
 IBA molecular function
GO:0005811 lipid droplet
 IEA cellular component
GO:0055114 oxidation-reduction proce
ss
 IEA biological process
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0006694 steroid biosynthetic proc
ess
 IEA biological process
GO:0006629 lipid metabolic process
 IEA biological process
GO:0016491 oxidoreductase activity
 IEA molecular function
GO:0004303 estradiol 17-beta-dehydro
genase activity
 IEA molecular function
GO:0004303 estradiol 17-beta-dehydro
genase activity
 TAS molecular function
GO:0005829 cytosol
 TAS cellular component
GO:0006703 estrogen biosynthetic pro
cess
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005811 lipid droplet
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005811 lipid droplet
 IDA cellular component
GO:0005811 lipid droplet
 IDA cellular component
GO:0006710 androgen catabolic proces
s
 IDA biological process
GO:0016229 steroid dehydrogenase act
ivity
 IDA molecular function
GO:0005737 cytoplasm
 IDA cellular component
GO:0016229 steroid dehydrogenase act
ivity
 IBA molecular function
GO:0005811 lipid droplet
 IBA cellular component
GO:0016616 oxidoreductase activity,
acting on the CH-OH group
of donors, NAD or NADP a
s acceptor
 IBA molecular function
GO:0005811 lipid droplet
 IEA cellular component
GO:0055114 oxidation-reduction proce
ss
 IEA biological process
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0006694 steroid biosynthetic proc
ess
 IEA biological process
GO:0006629 lipid metabolic process
 IEA biological process
GO:0016491 oxidoreductase activity
 IEA molecular function
GO:0004303 estradiol 17-beta-dehydro
genase activity
 IEA molecular function
GO:0004303 estradiol 17-beta-dehydro
genase activity
 TAS molecular function
GO:0005829 cytosol
 TAS cellular component
GO:0006703 estrogen biosynthetic pro
cess
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005811 lipid droplet
 IEA cellular component
GO:0005783 endoplasmic reticulum
 IEA cellular component
GO:0005811 lipid droplet
 IDA cellular component
GO:0005811 lipid droplet
 IDA cellular component

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract