• Gene id: 51164

Gene Summary

• Gene Symbol: DCTN4   Gene   UCSC   Ensembl
• Aliases: DYN4, P62
• Gene name: dynactin subunit 4
• Alternate names: dynactin subunit 4, dynactin 4 (p62), dynactin p62 subunit, dynactin subunit p62,
• Gene location: 5q33.1 (150759094: 150708439)     Exons: 19     NC_000005.10
• OMIM: 614758

Protein Summary

• Protein general information: Q9UJW0  
  • Name: Dynactin subunit 4 (Dyn4) (Dynactin subunit p62)
  • Length: 460  
  • Mass: 52337
• Sequence:

  MASLLQSDRVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPSAEAKLKKNRCANCFD
  CPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMADKSVASGGWQEPENPHTQRMNKLIEY
  YQQLAQKEKVERDRKKLARRRNYMPLAFSDKYGLGTRLQRPRAGASISTLAGLSLKEGEDQKEIKIEPAQAVDEV
  EPLPEDYYTRPVNLTEVTTLQQRLLQPDFQPVCASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQL
  VAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLFECEEGDPDDINSTAKVVVPPKELVLAGKDAAAE
  YDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFKMKHDFKNLAAPIRPIEESDQGTEVIWLTQH
  VELSLGPLLP

• Structural information:
  • Interpro: IPR008603  
  • STRING: ENSP00000414906
• Other Databases: GeneCards:  DCTN4  Malacards:  DCTN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005869	dynactin complex	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005869	dynactin complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005813	centrosome	TAS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000776	kinetochore	IEA	cellular component
GO:0005868	cytoplasmic dynein complex	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0001725	stress fiber	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0030017	sarcomere	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0047485	protein N-terminus binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)