• Gene id: 51162

Gene Summary

• Gene Symbol: EGFL7   Gene   UCSC   Ensembl
• Aliases: NEU1, VE-STATIN, ZNEU1
• Gene name: EGF like domain multiple 7
• Alternate names: epidermal growth factor-like protein 7, EGF-like protein 7, NOTCH4-like protein, multiple EGF-like domains protein 7, multiple epidermal growth factor-like domains protein 7, vascular endothelial statin,
• Gene location: 9q34.3 (136654752: 136672677)     Exons: 14     NC_000009.12
• Gene summary(Entrez): This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Al
• OMIM: 605713

Protein Summary

• Protein general information: Q9UHF1  
  • Name: Epidermal growth factor like protein 7 (EGF like protein 7) (Multiple epidermal growth factor like domains protein 7) (Multiple EGF like domains protein 7) (NOTCH4 like protein) (Vascular endothelial statin) (VE statin) (Zneu1)
  • Length: 273  
  • Mass: 29618
• Sequence:

  MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRR
  SPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQ
  RCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLA
  SQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS

• Structural information:
  • Protein Domains: (27..10-)
    (/note="EMI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00384-)
    (103..13-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (137..17-)
    (/note="EGF-like-)
    (-)
    (/evidence="ECO:0000255|PROSIT-)
  • Interpro: IPR001881  IPR013032  IPR000742  IPR018097  IPR013111   IPR011489  IPR009030  
  • Prosite: PS00010 PS00022 PS01186 PS50026 PS01187 PS51041
  • STRING: ENSP00000360764
• Other Databases: GeneCards:  EGFL7  Malacards:  EGFL7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001568	blood vessel development	ISS	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	ISS	cellular component
GO:0001570	vasculogenesis	ISS	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0048856	anatomical structure development	IBA	biological process
GO:0009986	cell surface	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0045746	negative regulation of Notch signaling pathway	IMP	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospadias	MIK: 22906644

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
22906644	Hypospadias	Methylation site (cg14197156)		20 (12 patients with isolated hypospadias and 8 healthy controls)	Male infertility	Microarray