• Gene id: 51160

Gene Summary

• Gene Symbol: VPS28   Gene   UCSC   Ensembl
• Gene name: VPS28 subunit of ESCRT-I
• Alternate names: vacuolar protein sorting-associated protein 28 homolog, ESCRT-I complex subunit VPS28, VPS28, ESCRT-I subunit, vacuolar protein sorting 28 homolog, vacuolar protein sorting 28-like protein, yeast class E protein Vps28p homolog,
• Gene location: 8q24.3 (144428562: 144423600)     Exons: 9     NC_000008.11
• Gene summary(Entrez): This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of env
• OMIM: 611952

Protein Summary

• Protein general information: Q9UK41  
  • Name: Vacuolar protein sorting associated protein 28 homolog (H Vps28) (ESCRT I complex subunit VPS28)
  • Length: 221  
  • Mass: 25425
• Sequence:

  MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAACSRLLV
  QYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAM
  DEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA

• Structural information:
  • Protein Domains: (13..12-)
    (/note="VPS28-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00645-)
    (124..22-)
    (/note="VPS28-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00642"-)
  • Interpro: IPR037202  IPR007143  IPR017899  IPR037206  IPR017898   IPR038358  
  • Prosite: PS51310 PS51313
  • STRING: ENSP00000366565
• Other Databases: GeneCards:  VPS28  Malacards:  VPS28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000813	ESCRT I complex	TAS	cellular component
GO:0036258	multivesicular body assembly	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0039702	viral budding via host ESCRT complex	TAS	biological process
GO:0043328	protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IBA	biological process
GO:0000813	ESCRT I complex	IBA	cellular component
GO:0044877	protein-containing complex binding	IBA	molecular function
GO:0000813	ESCRT I complex	IDA	cellular component
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IMP	biological process
GO:0000813	ESCRT I complex	IEA	cellular component
GO:0032509	endosome transport via multivesicular body sorting pathway	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0016197	endosomal transport	TAS	biological process
GO:0019058	viral life cycle	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0043657	host cell	IEA	cellular component
GO:0000813	ESCRT I complex	IDA	cellular component
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:0000813	ESCRT I complex	IDA	cellular component
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IC	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0000813	ESCRT I complex	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045732	positive regulation of protein catabolic process	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:2000397	positive regulation of ubiquitin-dependent endocytosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq