• Gene id: 51156

Gene Summary

• Gene Symbol: SERPINA10   Gene   UCSC   Ensembl
• Aliases: PZI, ZPI
• Gene name: serpin family A member 10
• Alternate names: protein Z-dependent protease inhibitor, PZ-dependent protease inhibitor, serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10, serpin A10, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin),
• Gene location: 14q32.13 (94293352: 94280459)     Exons: 7     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene belongs to the serpin family. It is predominantly expressed in the liver and secreted in plasma. It inhibits the activity of coagulation factors Xa and XIa in the presence of protein Z, calcium and phospholipid. Mutations
• OMIM: 616971

Protein Summary

• Protein general information: Q9UK55  
  • Name: Protein Z dependent protease inhibitor (PZ dependent protease inhibitor) (PZI) (Serpin A10)
  • Length: 444  
  • Mass: 50707
  • Tissue specificity: Expressed by the liver and secreted in plasma.
• Sequence:

  MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQL
  AKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRE
  TLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEIN
  PETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLV
  VLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGR
  NLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL

• Structural information:
  • Interpro: IPR023796  IPR000215  IPR036186  IPR042178  IPR042185   IPR033835  
  • CDD: cd02055
  • PDB: 3F1S 3H5C 4AFX 4AJU
  • PDBsum: 3F1S 3H5C 4AFX 4AJU
  • STRING: ENSP00000261994
• Other Databases: GeneCards:  SERPINA10  Malacards:  SERPINA10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0007596	blood coagulation	IEA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0007599	hemostasis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007596	blood coagulation	IEA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	TAS	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0060046	regulation of acrosome reaction	IDA	NOT|biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Thrombophilia	PMID:15461625
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881