• Gene id: 51155

Gene Summary

• Gene Symbol: JPT1   Gene   UCSC   Ensembl
• Aliases: ARM2, HN1, HN1A
• Gene name: Jupiter microtubule associated homolog 1
• Alternate names: jupiter microtubule associated homolog 1, androgen-regulated protein 2, hematological and neurological expressed 1 protein,
• Gene location: 17q25.1 (75154511: 75135242)     Exons: 7     NC_000017.11

Protein Summary

• Protein general information: Q9UK76  
  • Name: Jupiter microtubule associated homolog 1 (Androgen regulated protein 2) (Hematological and neurological expressed 1 protein) [Cleaved into: Jupiter microtubule associated homolog 1, N terminally processed]
  • Length: 154  
  • Mass: 16015
  • Tissue specificity: Expressed in testis, skeletal muscle, thymus, prostate, colon, peripheral blood cells, brain and placenta. {ECO
• Sequence:

  MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKSAGAKSSGGRE
  DLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSLGQSEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSS
  LVLG

• Structural information:
  • Interpro: IPR033335  
  • STRING: ENSP00000348316
• Other Databases: GeneCards:  JPT1  Malacards:  JPT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray