• Gene id: 51154

Gene Summary

• Gene Symbol: MRTO4   Gene   UCSC   Ensembl
• Aliases: C1orf33, MRT4, dJ657E11.4
• Gene name: MRT4 homolog, ribosome maturation factor
• Alternate names: mRNA turnover protein 4 homolog, 60S acidic ribosomal protein PO, MRT4, mRNA turnover 4, homolog, MRTO4 ribosome maturation factor, mRNA turnover 4 homolog, ribosome assembly factor MRTO4,
• Gene location: 1p36.13 (19251798: 19260127)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the encoded protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly. [provided by RefSeq

Protein Summary

• Protein general information: Q9UKD2  
  • Name: mRNA turnover protein 4 homolog (Ribosome assembly factor MRTO4)
  • Length: 239  
  • Mass: 27560
• Sequence:

  MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMV
  ALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSME
  PQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPES
  ASESTEESDSEDDD

• Structural information:
  • Interpro: IPR033867  IPR001790  IPR040637  
  • CDD: cd05796
  • STRING: ENSP00000364320
• Other Databases: GeneCards:  MRTO4  Malacards:  MRTO4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042273	ribosomal large subunit biogenesis	IBA	biological process
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0006364	rRNA processing	IBA	biological process
GO:0000956	nuclear-transcribed mRNA catabolic process	IBA	biological process
GO:0000027	ribosomal large subunit assembly	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)