• Gene id: 51149

Gene Summary

• Gene Symbol: MRNIP   Gene   UCSC   Ensembl
• Aliases: C5orf45
• Gene name: MRN complex interacting protein
• Alternate names: MRN complex-interacting protein, MRN-interacting protein, UPF0544 protein C5orf45,
• Gene location: 5q35.3 (179858816: 179837275)     Exons: 7     NC_000005.10
• OMIM: 600270

Protein Summary

• Protein general information: Q6NTE8  
  • Name: MRN complex interacting protein (MRN interacting protein)
  • Length: 343  
  • Mass: 37743
• Sequence:

  MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLNLLQGQVSELPLRSLE
  ETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELELEGTGVCFSKQPSSKMEEPGPRFSQDLPRKR
  KWSRSTVQPPCSRGVQDSGGSEVAWGPQKGQAGLTWKVKQGSSPCLQENSADCSAGELRGPGKELWSPIQQVTAT
  SSKWAQFVLPPRKSSHVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPTAAVQLPRATHPVTSGSERPC
  GKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV

• Structural information:
  • Interpro: IPR032739  
  • STRING: ENSP00000292586
• Other Databases: GeneCards:  MRNIP  Malacards:  MRNIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IDA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0030870	Mre11 complex	IDA	colocalizes with
GO:0071168	protein localization to chromatin	IDA	biological process
GO:0007095	mitotic G2 DNA damage checkpoint	IMP	biological process
GO:1905168	positive regulation of double-strand break repair via homologous recombination	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0010212	response to ionizing radiation	IMP	biological process
GO:0045860	positive regulation of protein kinase activity	IMP	biological process
GO:2001032	regulation of double-strand break repair via nonhomologous end joining	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray