• Gene id: 51147

Gene Summary

• Gene Symbol: ING4   Gene   UCSC   Ensembl
• Aliases: my036, p29ING4
• Gene name: inhibitor of growth family member 4
• Alternate names: inhibitor of growth protein 4, brain my036 protein, candidate tumor suppressor p33 ING1 homolog,
• Gene location: 12p13.31 (6663142: 6650300)     Exons: 9     NC_000012.12
• Gene summary(Entrez): This gene encodes a tumor suppressor protein that contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its
• OMIM: 615526

Protein Summary

• Protein general information: Q9UNL4  
  • Name: Inhibitor of growth protein 4 (p29ING4)
  • Length: 249  
  • Mass: 28530
• Sequence:

  MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQEAYGKC
  KEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNS
  DEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFA
  CVGLTTKPRGKWFCPRCSQERKKK

• Structural information:
  • Interpro: IPR028647  IPR028651  IPR024610  IPR019786  IPR011011   IPR001965  IPR019787  IPR013083  
  • Prosite: PS01359 PS50016
  • PDB: 2K1J 2M1R 2PNX 2VNF 4AFL
  • PDBsum: 2K1J 2M1R 2PNX 2VNF 4AFL
  • DIP: 42222
  • STRING: ENSP00000380024
• Other Databases: GeneCards:  ING4  Malacards:  ING4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0035064	methylated histone binding	IBA	molecular function
GO:0035064	methylated histone binding	IDA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0035064	methylated histone binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016573	histone acetylation	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0043983	histone H4-K12 acetylation	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0007050	cell cycle arrest	IDA	biological process
GO:0006260	DNA replication	IDA	biological process
GO:0043984	histone H4-K16 acetylation	IDA	NOT|biological process
GO:0043981	histone H4-K5 acetylation	IDA	biological process
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IDA	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0000123	histone acetyltransferase complex	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0006473	protein acetylation	IDA	biological process
GO:0045926	negative regulation of growth	IDA	biological process
GO:0043982	histone H4-K8 acetylation	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq