• Gene id: 51143

Gene Summary

• Gene Symbol: DYNC1LI1   Gene   UCSC   Ensembl
• Aliases: DLC-A, DNCLI1, LIC1
• Gene name: dynein cytoplasmic 1 light intermediate chain 1
• Alternate names: cytoplasmic dynein 1 light intermediate chain 1, dynein light chain A, dynein light intermediate chain 1, cytosolic, dynein, cytoplasmic, light intermediate polypeptide 1,
• Gene location: 3p22.3 (32570923: 32525970)     Exons: 13     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene belongs to light intermediate subunit family, whose members are components of the multiprotein cytoplasmic dynein complex, which is involved in intracellular trafficking and chromosome segregation during mitosis. The prote
• OMIM: 615890

Protein Summary

• Protein general information: Q9Y6G9  
  • Name: Cytoplasmic dynein 1 light intermediate chain 1 (LIC1) (Dynein light chain A) (DLC A) (Dynein light intermediate chain 1, cytosolic)
  • Length: 523  
  • Mass: 56579
• Sequence:

  MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRSRSKLPAGKNVLLLGE
  DGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVWILDGDLYHKGLLKFSLDAVSLKDTLVMLVV
  DMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVL
  PLGADTLTHNLGIPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYI
  VQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFEDIITKPPVRKFVHEKEIMAEDDQVF
  LMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASVSPIPAGSKKIDPNMKAGATSEGVLANFFNS
  LLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQKPVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS

• Structural information:
  • Interpro: IPR008467  IPR022780  IPR027417  
  • PDB: 6B9H
  • PDBsum: 6B9H
  • STRING: ENSP00000273130
• Other Databases: GeneCards:  DYNC1LI1  Malacards:  DYNC1LI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005868	cytoplasmic dynein complex	IBA	cellular component
GO:0045504	dynein heavy chain binding	IBA	molecular function
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0005868	cytoplasmic dynein complex	IEA	cellular component
GO:0007018	microtubule-based movement	IEA	biological process
GO:0030286	dynein complex	IEA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0003774	motor activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005525	GTP binding	IDA	NOT|molecular function
GO:0019003	GDP binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045504	dynein heavy chain binding	IPI	molecular function
GO:0005868	cytoplasmic dynein complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0000922	spindle pole	IDA	cellular component
GO:0005868	cytoplasmic dynein complex	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0090267	positive regulation of mitotic cell cycle spindle assembly checkpoint	IMP	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa04145	Phagosome
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray