• Gene id: 51141

Gene Summary

• Gene Symbol: INSIG2   Gene   UCSC   Ensembl
• Aliases: INSIG-2
• Gene name: insulin induced gene 2
• Alternate names: insulin-induced gene 2 protein, INSIG2 membrane protein, insulin induced protein 2,
• Gene location: 2q14.1-q14.2 (118088417: 118110996)     Exons: 7     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by b
• OMIM: 606468

Protein Summary

• Protein general information: Q9Y5U4  
  • Name: Insulin induced gene 2 protein (INSIG 2)
  • Length: 225  
  • Mass: 24778
• Sequence:

  MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPP
  CCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDR
  SRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE

• Structural information:
  • Interpro: IPR025929  
  • PDB: 4J82
  • PDBsum: 4J82
  • DIP: 60913
  • STRING: ENSP00000245787
• Other Databases: GeneCards:  INSIG2  Malacards:  INSIG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032937	SREBP-SCAP-Insig complex	IBA	cellular component
GO:0032933	SREBP signaling pathway	IBA	biological process
GO:0032869	cellular response to insulin stimulus	IBA	biological process
GO:0006695	cholesterol biosynthetic process	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0036316	SREBP-SCAP complex retention in endoplasmic reticulum	IBA	biological process
GO:0016126	sterol biosynthetic process	IBA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0008202	steroid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0032868	response to insulin	IEA	biological process
GO:0033993	response to lipid	IEA	biological process
GO:0006695	cholesterol biosynthetic process	IEA	biological process
GO:0006991	response to sterol depletion	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0045717	negative regulation of fatty acid biosynthetic process	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0070542	response to fatty acid	IEA	biological process
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0010894	negative regulation of steroid biosynthetic process	IEA	biological process
GO:0016126	sterol biosynthetic process	IEA	biological process
GO:0042474	middle ear morphogenesis	IEA	biological process
GO:0060021	roof of mouth development	IEA	biological process
GO:0060363	cranial suture morphogenesis	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0032937	SREBP-SCAP-Insig complex	IDA	cellular component
GO:0032933	SREBP signaling pathway	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray