• Gene id: 51138

Gene Summary

• Gene Symbol: COPS4   Gene   UCSC   Ensembl
• Aliases: CSN4, SGN4
• Gene name: COP9 signalosome subunit 4
• Alternate names: COP9 signalosome complex subunit 4, COP9 constitutive photomorphogenic homolog subunit 4, COP9 constitutive photomorphogenic-like protein subunit 4, JAB1-containing signalosome subunit 4, signalosome subunit 4, testis tissue sperm-binding protein Li 42a,
• Gene location: 4q21.22 (16237444: 16231691)     Exons: 5     NC_000001.11
• Gene summary(Entrez): This gene encodes one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S re
• OMIM: 616008

Protein Summary

• Protein general information: Q9BT78  
  • Name: COP9 signalosome complex subunit 4 (SGN4) (Signalosome subunit 4) (JAB1 containing signalosome subunit 4)
  • Length: 406  
  • Mass: 46269
• Sequence:

  MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGAEQLEALKAFVEAMVNENVSLVISRQLLTDFCTHLPN
  LPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLK
  IARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEA
  LKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSIL
  DRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREALPTWDKQIQ
  SLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ

• Structural information:
  • Protein Domains: (197..36-)
    (/note="PCI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01185"-)
  • Interpro: IPR037754  IPR041406  IPR000717  IPR040134  IPR036388   IPR036390  
  • Prosite: PS50250
  • PDB: 4D0P 4D10 4D18 4WSN 6R6H 6R7F 6R7H 6R7I 6R7N
  • PDBsum: 4D0P 4D10 4D18 4WSN 6R6H 6R7F 6R7H 6R7I 6R7N
  • DIP: 34516
  • STRING: ENSP00000264389
• Other Databases: GeneCards:  COPS4  Malacards:  COPS4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019784	NEDD8-specific protease activity	IBA	contributes to
GO:0008180	COP9 signalosome	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0008021	synaptic vesicle	IDA	cellular component
GO:0000338	protein deneddylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000338	protein deneddylation	IMP	biological process
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0019784	NEDD8-specific protease activity	TAS	molecular function
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881