• Gene id: 51135

Gene Summary

• Gene Symbol: IRAK4   Gene   UCSC   Ensembl
• Aliases: IPD1, IRAK-4, NY-REN-64, REN64
• Gene name: interleukin 1 receptor associated kinase 4
• Alternate names: interleukin-1 receptor-associated kinase 4, renal carcinoma antigen NY-REN-64,
• Gene location: 12q12 (43758908: 43789542)     Exons: 19     NC_000012.12
• Gene summary(Entrez): This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurre
• OMIM: 600924

Protein Summary

• Protein general information: Q9NWZ3  
  • Name: Interleukin 1 receptor associated kinase 4 (IRAK 4) (EC 2.7.11.1) (Renal carcinoma antigen NY REN 64)
  • Length: 460  
  • Mass: 51530
• Sequence:

  MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWG
  TTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDS
  SSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEE
  LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
  FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGV
  VLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKV
  QQLLQEMTAS

• Structural information:
  • Protein Domains: (20..10-)
    (/note="Death-)
    (186..45-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011029  IPR017428  IPR037970  IPR011009  IPR000719   IPR001245  
  • Prosite: PS50011
  • CDD: cd08793
  • PDB: 2NRU 2NRY 2O8Y 2OIB 2OIC 2OID 3MOP 4RMZ 4U97 4U9A 4XS2 4Y73 4YO6 4YP8 4ZTL 4ZTM 4ZTN 5K72 5K75 5K76 5K7G 5K7I 5KX7 5KX8 5T1S 5T1T 5UIQ 5UIR 5UIS 5UIT 5UIU 5W84 5W85 6EG9 6EGA 6EGD 6EGE 6EGF 6F3D 6F3E 6F3G 6F3I 6MOM 6N8G 6O8U 6O94 6O95 6O9D 6RFI 6RFJ 6UYA
  • PDBsum: 2NRU 2NRY 2O8Y 2OIB 2OIC 2OID 3MOP 4RMZ 4U97 4U9A 4XS2 4Y73 4YO6 4YP8 4ZTL 4ZTM 4ZTN 5K72 5K75 5K76 5K7G 5K7I 5KX7 5KX8 5T1S 5T1T 5UIQ 5UIR 5UIS 5UIT 5UIU 5W84 5W85 6EG9 6EGA 6EGD 6EGE 6EGF 6F3D 6F3E 6F3G 6F3I 6MOM 6N8G 6O8U 6O94 6O95 6O9D 6RFI 6RFJ 6UYA
  • DIP: 31351
  • STRING: ENSP00000390651
• Other Databases: GeneCards:  IRAK4  Malacards:  IRAK4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:1990266	neutrophil migration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002446	neutrophil mediated immunity	IMP	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0004672	protein kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0034162	toll-like receptor 9 signaling pathway	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0007254	JNK cascade	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0005149	interleukin-1 receptor binding	IEA	molecular function
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0001816	cytokine production	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04010	MAPK signaling pathway
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa04621	NOD-like receptor signaling pathway
hsa05152	Tuberculosis
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05135	Yersinia infection
hsa04722	Neurotrophin signaling pathway
hsa05162	Measles
hsa04064	NF-kappa B signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa05145	Toxoplasmosis
hsa05142	Chagas disease
hsa05133	Pertussis
hsa05140	Leishmaniasis

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray