• Gene id: 51131

Gene Summary

• Gene Symbol: PHF11   Gene   UCSC   Ensembl
• Aliases: APY, BCAP, IGEL, IGER, IGHER, NY-REN-34, NYREN34
• Gene name: PHD finger protein 11
• Alternate names: PHD finger protein 11, BRCA1 C-terminus-associated protein, IgE responsiveness (atopic), renal carcinoma antigen NY-REN-34,
• Gene location: 13q14.2 (49495952: 49528991)     Exons: 13     NC_000013.11
• Gene summary(Entrez): This gene encodes a protein containing a PHD (plant homeodomain) type zinc finger. This gene has been identified in some studies as a candidate gene for asthma. Naturally-occurring readthrough transcription may occur from the upstream SETDB2 (SET domain b
• OMIM: 607796

Protein Summary

• Protein general information: Q9UIL8  
  • Name: PHD finger protein 11 (BRCA1 C terminus associated protein) (Renal carcinoma antigen NY REN 34)
  • Length: 331  
  • Mass: 37582
  • Tissue specificity: Highly expressed in T and B-cells, as well as natural killer and mature dendritic cells. Expressed at higher levels in Th1 as compared to Th2 cells. Expressed at low levels in all normal tissues tested, including lung, testis, small in
• Sequence:

  MAQASPPRPERVLGASSPEARPAQEALLLPTGVFQVAEKMEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYS
  SGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRG
  IYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCK
  EAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEI
  ELLQDLKQTLCSFQENRDLMSSSTSISSLSY

• Structural information:
  • Interpro: IPR034732  IPR011011  IPR001965  IPR013083  
  • Prosite: PS51805
  • STRING: ENSP00000367570
• Other Databases: GeneCards:  PHF11  Malacards:  PHF11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)