• Gene id: 51129

Gene Summary

• Gene Symbol: ANGPTL4   Gene   UCSC   Ensembl
• Aliases: ARP4, FIAF, HARP, HFARP, NL2, PGAR, TGQTL, UNQ171, pp1158
• Gene name: angiopoietin like 4
• Alternate names: angiopoietin-related protein 4, PPARG angiopoietin related protein, fasting-induced adipose factor, hepatic angiopoietin-related protein, hepatic fibrinogen/angiopoietin-related protein, peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoie,
• Gene location: 19p13.2 (8364128: 8374372)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and
• OMIM: 611661

Protein Summary

• Protein general information: Q9BY76  
  • Name: Angiopoietin related protein 4 (Angiopoietin like protein 4) (Hepatic fibrinogen/angiopoietin related protein) (HFARP) [Cleaved into: ANGPTL4 N terminal chain; ANGPTL4 C terminal chain]
  • Length: 406  
  • Mass: 45214
  • Tissue specificity: Detected in blood plasma (at protein level) (PubMed
• Sequence:

  MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSA
  CGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHK
  HLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWT
  VIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAY
  SLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLK
  KGIFWKTWRGRYYPLQATTMLIQPMAAEAAS

• Structural information:
  • Protein Domains: (179..40-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR028793  IPR036056  IPR002181  IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • PDB: 6EUB 6U0A 6U1U 6U73
  • PDBsum: 6EUB 6U0A 6U1U 6U73
  • STRING: ENSP00000301455
• Other Databases: GeneCards:  ANGPTL4  Malacards:  ANGPTL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043335	protein unfolding	IDA	biological process
GO:0051005	negative regulation of lipoprotein lipase activity	IDA	biological process
GO:0070328	triglyceride homeostasis	IBA	biological process
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0031589	cell-substrate adhesion	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004857	enzyme inhibitor activity	IBA	molecular function
GO:0001525	angiogenesis	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0051005	negative regulation of lipoprotein lipase activity	IEA	biological process
GO:0070328	triglyceride homeostasis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0051005	negative regulation of lipoprotein lipase activity	IDA	biological process
GO:0070328	triglyceride homeostasis	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0004857	enzyme inhibitor activity	ISS	molecular function
GO:0045766	positive regulation of angiogenesis	TAS	biological process
GO:0001666	response to hypoxia	NAS	biological process
GO:0043335	protein unfolding	IDA	biological process
GO:0051005	negative regulation of lipoprotein lipase activity	IDA	biological process
GO:0070328	triglyceride homeostasis	IBA	biological process
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0031589	cell-substrate adhesion	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004857	enzyme inhibitor activity	IBA	molecular function
GO:0001525	angiogenesis	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0051005	negative regulation of lipoprotein lipase activity	IEA	biological process
GO:0070328	triglyceride homeostasis	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0051005	negative regulation of lipoprotein lipase activity	IDA	biological process
GO:0070328	triglyceride homeostasis	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0004857	enzyme inhibitor activity	ISS	molecular function
GO:0045766	positive regulation of angiogenesis	TAS	biological process
GO:0001666	response to hypoxia	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa03320	PPAR signaling pathway
hsa04979	Cholesterol metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq