• Gene id: 51128

Gene Summary

• Gene Symbol: SAR1B   Gene   UCSC   Ensembl
• Aliases: ANDD, CMRD, GTBPB, SARA2
• Gene name: secretion associated Ras related GTPase 1B
• Alternate names: GTP-binding protein SAR1b, 2310075M17Rik, GTP-binding protein B, GTP-binding protein Sara, SAR1 homolog B, SAR1a gene homolog 2,
• Gene location: 5q31.1 (134632827: 134601148)     Exons: 8     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is
• OMIM: 607690

Protein Summary

• Protein general information: Q9Y6B6  
  • Name: GTP binding protein SAR1b (GTP binding protein B) (GTBPB)
  • Length: 198  
  • Mass: 22410
  • Tissue specificity: Expressed in many tissues including small intestine, liver, muscle and brain.
• Sequence:

  MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFD
  LGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREM
  FGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR006689  IPR006687  
  • Prosite: PS51422
  • STRING: ENSP00000385432
• Other Databases: GeneCards:  SAR1B  Malacards:  SAR1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061024	membrane organization	IBA	biological process
GO:0016050	vesicle organization	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0003400	regulation of COPII vesicle coating	IBA	biological process
GO:0070971	endoplasmic reticulum exit site	IBA	cellular component
GO:0070863	positive regulation of protein exit from endoplasmic reticulum	IBA	biological process
GO:0030127	COPII vesicle coat	IBA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum
hsa05134	Legionellosis

Diseases

Associated diseases	References
Chylomicron retention disease	KEGG:H00927
Chylomicron retention disease	KEGG:H00927
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R