• Gene id: 51126

Gene Summary

• Gene Symbol: NAA20   Gene   UCSC   Ensembl
• Aliases: NAT3, NAT3P, NAT5, NAT5P, dJ1002M8.1
• Gene name: N-alpha-acetyltransferase 20, NatB catalytic subunit
• Alternate names: N-alpha-acetyltransferase 20, N-acetyltransferase 3 homolog, N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), N-acetyltransferase 5 (GCN5-related, putative), N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, homolog), N-terminal acety,
• Gene location: 20p11.23 (115114132: 114824121)     Exons: 14     NC_000004.12
• Gene summary(Entrez): NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIM, Apr 200
• OMIM: 610833

Protein Summary

• Protein general information: P61599  
  • Name: N alpha acetyltransferase 20 (EC 2.3.1.254) (Methionine N acetyltransferase) (N acetyltransferase 5) (N terminal acetyltransferase B complex catalytic subunit NAA20) (N terminal acetyltransferase B complex catalytic subunit NAT5) (NatB complex subunit NAT
  • Length: 178  
  • Mass: 20368
• Sequence:

  MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVT
  ALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAY
  DMRKALSRDTEKKSIIPLPHPVRPEDIE

• Structural information:
  • Protein Domains: (2..15-)
    (/note="N-acetyltransferase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00532"-)
  • Interpro: IPR016181  IPR000182  
  • Prosite: PS51186
  • STRING: ENSP00000335636
• Other Databases: GeneCards:  NAA20  Malacards:  NAA20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004596	peptide alpha-N-acetyltransferase activity	IBA	molecular function
GO:0031416	NatB complex	IBA	cellular component
GO:0017196	N-terminal peptidyl-methionine acetylation	IBA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray