• Gene id: 51125

Gene Summary

• Gene Symbol: GOLGA7   Gene   UCSC   Ensembl
• Aliases: GCP16, GOLGA3AP1, GOLGA7A, HSPC041
• Gene name: golgin A7
• Alternate names: golgin subfamily A member 7, Golgi complex-associated protein of 16kDa, golgi autoantigen, golgin subfamily a, 7, golgi complex-associated protein of 16 kDa,
• Gene location: 8p11.21 (41490395: 41510979)     Exons: 6     NC_000008.11
• OMIM: 609453

Protein Summary

• Protein general information: Q7Z5G4  
  • Name: Golgin subfamily A member 7 (Golgi complex associated protein of 16 kDa)
  • Length: 137  
  • Mass: 15824
  • Tissue specificity: Expressed in all tissues except colon and thymus. {ECO
• Sequence:

  MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTA
  YTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR

• Structural information:
  • Interpro: IPR019383  
  • STRING: ENSP00000350378
• Other Databases: GeneCards:  GOLGA7  Malacards:  GOLGA7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	contributes to
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0005795	Golgi stack	IBA	cellular component
GO:0002178	palmitoyltransferase complex	IBA	cellular component
GO:0043001	Golgi to plasma membrane protein transport	IBA	biological process
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006893	Golgi to plasma membrane transport	IDA	biological process
GO:0000139	Golgi membrane	IDA	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0043001	Golgi to plasma membrane protein transport	IDA	biological process
GO:0031228	intrinsic component of Golgi membrane	IDA	cellular component
GO:0031228	intrinsic component of Golgi membrane	IDA	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0005795	Golgi stack	IDA	cellular component
GO:0002178	palmitoyltransferase complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)