• Gene id: 51123

Gene Summary

• Gene Symbol: ZNF706   Gene   UCSC   Ensembl
• Aliases: HSPC038, PNAS-106, PNAS-113
• Gene name: zinc finger protein 706
• Alternate names: zinc finger protein 706,
• Gene location: 8q22.3 (101206469: 101197037)     Exons: 7     NC_000008.11
• OMIM: 606702

Protein Summary

• Protein general information: Q9Y5V0  
  • Name: Zinc finger protein 706
  • Length: 76  
  • Mass: 8498
• Sequence:

  MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQ
  A

• Structural information:
  • Interpro: IPR007513  IPR026939  
  • Prosite: PS00028
  • STRING: ENSP00000430823
• Other Databases: GeneCards:  ZNF706  Malacards:  ZNF706

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:1902455	negative regulation of stem cell population maintenance	ISS	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:1902455	negative regulation of stem cell population maintenance	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray