• Gene id: 51121

Gene Summary

• Gene Symbol: RPL26L1   Gene   UCSC   Ensembl
• Aliases: RPL26P1
• Gene name: ribosomal protein L26 like 1
• Alternate names: 60S ribosomal protein L26-like 1, large ribosomal subunit protein uL24-like 1, ribosomal protein L26 homolog, ribosomal protein L26 pseudogene 1,
• Gene location: 5q35.1 (172953676: 172969770)     Exons: 7     NC_000005.10
• Gene summary(Entrez): This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Dec 2015]
• OMIM: 0

Protein Summary

• Protein general information: Q9UNX3  
  • Name: 60S ribosomal protein L26 like 1 (Large ribosomal subunit protein uL24 like 1)
  • Length: 145  
  • Mass: 17256
• Sequence:

  MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYR
  KKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE

• Structural information:
  • Interpro: IPR005824  IPR041988  IPR014722  IPR005825  IPR005756   IPR008991  
  • Prosite: PS01108
  • CDD: cd06089
  • STRING: ENSP00000428223
• Other Databases: GeneCards:  RPL26L1  Malacards:  RPL26L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042273	ribosomal large subunit biogenesis	IBA	biological process
GO:0022625	cytosolic large ribosomal subunit	IBA	cellular component
GO:0002181	cytoplasmic translation	IBA	biological process
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0015934	large ribosomal subunit	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray