• Gene id: 51112

Gene Summary

• Gene Symbol: TRAPPC12   Gene   UCSC   Ensembl
• Aliases: CGI-87, PEBAS, TTC-15, TTC15
• Gene name: trafficking protein particle complex 12
• Alternate names: trafficking protein particle complex subunit 12, TPR repeat protein 15, tetratricopeptide repeat domain 15, tetratricopeptide repeat protein 15, trafficking of membranes and mitosis,
• Gene location: 2p25.3 (3379244: 3479570)     Exons: 20     NC_000002.12
• OMIM: 614139

Protein Summary

• Protein general information: Q8WVT3  
  • Name: Trafficking protein particle complex subunit 12 (Tetratricopeptide repeat protein 15) (TPR repeat protein 15) (TTC 15) (Trafficking of membranes and mitosis)
  • Length: 735  
  • Mass: 79375
• Sequence:

  MEDAGGGEETPAPEAPHPPQLAPPEEQGLLFQEETIDLGGDEFGSEENETASEGSSPLADKLNEHMMESVLISDS
  PNSEGDAGDLGRVRDEAEPGGEGDPGPEPAGTPSPSGEADGDCAPEDAAPSSGGAPRQDAAREVPGSEAARPEQE
  PPVAEPVPVCTIFSQRAPPASGDGFEPQMVKSPSFGGASEASARTPPQVVQPSPSLSTFFGDTAASHSLASDFFD
  SFTTSAFISVSNPGAGSPAPASPPPLAVPGTEGRPEPVAMRGPQAAAPPASPEPFAHIQAVFAGSDDPFATALSM
  SEMDRRNDAWLPGEATRGVLRAVATQQRGAVFVDKENLTMPGLRFDNIQGDAVKDLMLRFLGEKAAAKRQVLNAD
  SVEQSFVGLKQLISCRNWRAAVDLCGRLLTAHGQGYGKSGLLTSHTTDSLQLWFVRLALLVKLGLFQNAEMEFEP
  FGNLDQPDLYYEYYPHVYPGRRGSMVPFSMRILHAELQQYLGNPQESLDRLHKVKTVCSKILANLEQGLAEDGGM
  SSVTQEGRQASIRLWRSRLGRVMYSMANCLLLMKDYVLAVEAYHSVIKYYPEQEPQLLSGIGRISLQIGDIKTAE
  KYFQDVEKVTQKLDGLQGKIMVLMNSAFLHLGQNNFAEAHRFFTEILRMDPRNAVANNNAAVCLLYLGKLKDSLR
  QLEAMVQQDPRHYLHESVLFNLTTMYELESSRSMQKKQALLEAVAGKEGDSFNTQCLKLA

• Structural information:
  • Interpro: IPR013026  IPR011990  IPR019734  
  • Prosite: PS50005 PS50293
  • DIP: 48283
  • STRING: ENSP00000324318
• Other Databases: GeneCards:  TRAPPC12  Malacards:  TRAPPC12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004175	endopeptidase activity	IBA	molecular function
GO:0000776	kinetochore	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1905342	positive regulation of protein localization to kinetochore	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0090234	regulation of kinetochore assembly	IMP	biological process
GO:0051310	metaphase plate congression	IMP	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0030008	TRAPP complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IMP	colocalizes with
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IMP	colocalizes with
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray