• Gene id: 5111

Gene Summary

• Gene Symbol: PCNA   Gene   UCSC   Ensembl
• Aliases: ATLD2
• Gene name: proliferating cell nuclear antigen
• Alternate names: proliferating cell nuclear antigen, DNA polymerase delta auxiliary protein, cyclin,
• Gene location: 20p12.3 (5126621: 5114952)     Exons: 7     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage,
• OMIM: 176740

Protein Summary

• Protein general information: P12004  
  • Name: Proliferating cell nuclear antigen (PCNA) (Cyclin)
  • Length: 261  
  • Mass: 28,769
• Sequence:

  MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSM
  SKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRD
  LSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTV
  TLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

• Structural information:
  • Interpro: IPR000730  IPR022649  IPR022659  IPR022648  
  • Prosite: PS01251 PS00293
  • PDB: 1AXC 1U76 1U7B 1UL1 1VYJ 1VYM 1W60 2ZVK 2ZVL 2ZVM 3JA9 3P87 3TBL 3VKX 3WGW 4D2G 4RJF 4ZTD 5E0T 5E0U 5E0V 5IY4 5L7C 5MAV 5MLO 5MLW 5MOM 5YCO
  • PDBsum: 1AXC 1U76 1U7B 1UL1 1VYJ 1VYM 1W60 2ZVK 2ZVL 2ZVM 3JA9 3P87 3TBL 3VKX 3WGW 4D2G 4RJF 4ZTD 5E0T 5E0U 5E0V 5IY4 5L7C 5MAV 5MLO 5MLW 5MOM 5YCO
  • DIP: 1098
  • STRING: ENSP00000368438
• Other Databases: GeneCards:  PCNA  Malacards:  PCNA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000701	purine-specific mismatch base pair DNA N-glycosylase activity	IDA	molecular function
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000723	telomere maintenance	TAS	biological process
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005663	DNA replication factor C complex	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0006271	DNA strand elongation involved in DNA replication	TAS	biological process
GO:0006272	leading strand elongation	IBA	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0006296	nucleotide-excision repair, DNA incision, 5'-to lesion	TAS	biological process
GO:0006297	nucleotide-excision repair, DNA gap filling	TAS	biological process
GO:0006298	mismatch repair	IDA	biological process
GO:0006298	mismatch repair	TAS	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0007507	heart development	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019985	translesion synthesis	IDA	biological process
GO:0019985	translesion synthesis	TAS	biological process
GO:0030331	estrogen receptor binding	IEA	molecular function
GO:0030337	DNA polymerase processivity factor activity	IBA	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0030894	replisome	TAS	cellular component
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0031297	replication fork processing	ISS	biological process
GO:0032077	positive regulation of deoxyribonuclease activity	IDA	biological process
GO:0032139	dinucleotide insertion or deletion binding	IDA	molecular function
GO:0032405	MutLalpha complex binding	IDA	molecular function
GO:0033683	nucleotide-excision repair, DNA incision	TAS	biological process
GO:0033993	response to lipid	IEA	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0035035	histone acetyltransferase binding	IPI	molecular function
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043596	nuclear replication fork	IDA	cellular component
GO:0043626	PCNA complex	IDA	cellular component
GO:0045739	positive regulation of DNA repair	IMP	biological process
GO:0045740	positive regulation of DNA replication	IMP	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:0070557	PCNA-p21 complex	IDA	cellular component
GO:0070987	error-free translesion synthesis	TAS	biological process
GO:1902990	mitotic telomere maintenance via semi-conservative replication	ISS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000701	purine-specific mismatch base pair DNA N-glycosylase activity	IDA	molecular function
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000723	telomere maintenance	TAS	biological process
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005663	DNA replication factor C complex	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0006271	DNA strand elongation involved in DNA replication	TAS	biological process
GO:0006272	leading strand elongation	IBA	biological process
GO:0006275	regulation of DNA replication	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0006296	nucleotide-excision repair, DNA incision, 5'-to lesion	TAS	biological process
GO:0006297	nucleotide-excision repair, DNA gap filling	TAS	biological process
GO:0006298	mismatch repair	IDA	biological process
GO:0006298	mismatch repair	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0007507	heart development	IEA	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019985	translesion synthesis	IDA	biological process
GO:0019985	translesion synthesis	TAS	biological process
GO:0030331	estrogen receptor binding	IEA	molecular function
GO:0030337	DNA polymerase processivity factor activity	IEA	molecular function
GO:0030337	DNA polymerase processivity factor activity	IBA	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0030894	replisome	TAS	cellular component
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0031297	replication fork processing	ISS	biological process
GO:0032077	positive regulation of deoxyribonuclease activity	IDA	biological process
GO:0032139	dinucleotide insertion or deletion binding	IDA	molecular function
GO:0032405	MutLalpha complex binding	IDA	molecular function
GO:0033683	nucleotide-excision repair, DNA incision	TAS	biological process
GO:0033993	response to lipid	IEA	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0035035	histone acetyltransferase binding	IPI	molecular function
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043596	nuclear replication fork	IDA	cellular component
GO:0043626	PCNA complex	IDA	cellular component
GO:0045739	positive regulation of DNA repair	IMP	biological process
GO:0045740	positive regulation of DNA replication	IMP	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:0070557	PCNA-p21 complex	IDA	cellular component
GO:0070987	error-free translesion synthesis	TAS	biological process
GO:1902990	mitotic telomere maintenance via semi-conservative replication	ISS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000701	purine-specific mismatch base pair DNA N-glycosylase activity	IDA	molecular function
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000722	telomere maintenance via recombination	TAS	biological process
GO:0000723	telomere maintenance	TAS	biological process
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005663	DNA replication factor C complex	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0006271	DNA strand elongation involved in DNA replication	TAS	biological process
GO:0006272	leading strand elongation	IBA	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0006296	nucleotide-excision repair, DNA incision, 5'-to lesion	TAS	biological process
GO:0006297	nucleotide-excision repair, DNA gap filling	TAS	biological process
GO:0006298	mismatch repair	IDA	biological process
GO:0006298	mismatch repair	TAS	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0008283	cell proliferation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019985	translesion synthesis	IDA	biological process
GO:0019985	translesion synthesis	TAS	biological process
GO:0030337	DNA polymerase processivity factor activity	IBA	molecular function
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0030894	replisome	TAS	cellular component
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0031297	replication fork processing	ISS	biological process
GO:0032077	positive regulation of deoxyribonuclease activity	IDA	biological process
GO:0032139	dinucleotide insertion or deletion binding	IDA	molecular function
GO:0032405	MutLalpha complex binding	IDA	molecular function
GO:0033683	nucleotide-excision repair, DNA incision	TAS	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0035035	histone acetyltransferase binding	IPI	molecular function
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043596	nuclear replication fork	IDA	cellular component
GO:0043626	PCNA complex	IDA	cellular component
GO:0045739	positive regulation of DNA repair	IMP	biological process
GO:0045740	positive regulation of DNA replication	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:0070182	DNA polymerase binding	IPI	molecular function
GO:0070557	PCNA-p21 complex	IDA	cellular component
GO:0070987	error-free translesion synthesis	TAS	biological process
GO:1902990	mitotic telomere maintenance via semi-conservative replication	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa04530	Tight junction
hsa05161	Hepatitis B

Diseases

Associated diseases	References
Cancer (cervical)	GAD: 19012493
Cancer (lung)	GAD: 16195237
Cancer (ovarian)	GAD: 19950226
Cancer (endometrial)	INFBASE: 22056701
Cancer	GAD: 19692168
Cancer (bladder)	GAD: 17203305
Cancer (brain)	GAD: 20150366
Cancer (colorectal)	GAD: 19536092
Cancer (esophageal)	GAD: 19339270
Cancer (Hematologic)	GAD: 20226869
Cancer (breast)	GAD: 18669164
Multiple sclerosis	GAD: 20522537
Chronic renal failure	GAD: 21085059
Endometriosis	INFBASE: 22056701
Germinal arrest	MIK: 11250796
Sertoli cell only syndrome (SCOS)	MIK: 11250796
Hypospermatogenesis	MIK: 11250796
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 11250796
Germinal arrest	MIK: 11250796
Sertoli cell only syndrome	MIK: 11250796
Male infertility	MIK: 11704108
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
11704108	Hypospermatogenesis, male infertility			34 patients with idiopathic hypospermatogenesis	Male infertility
11250796	Hypospermatogenesis, germinal arrest, Sertoli cell only syndrome			48 (14 normal spermatogenesis, 16 hypospermatogenesis, 10 germinal arrest, 8 Sertoli cell only syndrome)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881