• Gene id: 51109

Gene Summary

• Gene Symbol: RDH11   Gene   UCSC   Ensembl
• Aliases: ARSDR1, CGI82, HCBP12, MDT1, PSDR1, RALR1, RDJCSS, SCALD, SDR7C1
• Gene name: retinol dehydrogenase 11
• Alternate names: retinol dehydrogenase 11, HCV core-binding protein HCBP12, androgen-regulated short-chain dehydrogenase/reductase 1, prostate short-chain dehydrogenase reductase 1, retinal reductase 1, retinol dehydrogenase 11 (all-trans/9-cis/11-cis), short chain dehydrogenas,
• Gene location: 14q24.1 (67695763: 67676799)     Exons: 7     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is an NADPH-dependent retinal reductase and a short-chain dehydrogenase/reductase. The encoded protein has no steroid dehydrogenase activity. [provided by RefSeq, Nov 2011]
• OMIM: 605559

Protein Summary

• Protein general information: Q8TC12  
  • Name: Retinol dehydrogenase 11 (EC 1.1.1.300) (Androgen regulated short chain dehydrogenase/reductase 1) (HCV core binding protein HCBP12) (Prostate short chain dehydrogenase/reductase 1) (Retinal reductase 1) (RalR1) (Short chain dehydrogenase/reductase family
  • Length: 318  
  • Mass: 35386
  • Tissue specificity: Predominantly expressed in the epithelial cells of prostate, in both basal and luminal secretory cell populations. Expressed at low levels in spleen, thymus, testis, ovary, small intestine, colon, peripherical blood leukocytes, kidney,
• Sequence:

  MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDV
  EKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNH
  LGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGV
  TTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNET
  IARRLWDVSCDLLGLPID

• Structural information:
  • Interpro: IPR036291  IPR002347  
  • STRING: ENSP00000370750
• Other Databases: GeneCards:  RDH11  Malacards:  RDH11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0110095	cellular detoxification of aldehyde	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0001523	retinoid metabolic process	IDA	biological process
GO:0052650	NADP-retinol dehydrogenase activity	IDA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0052650	NADP-retinol dehydrogenase activity	IEA	molecular function
GO:0052650	NADP-retinol dehydrogenase activity	IDA	molecular function
GO:0042574	retinal metabolic process	IDA	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0042572	retinol metabolic process	IEA	biological process
GO:0042572	retinol metabolic process	ISS	biological process
GO:0004745	retinol dehydrogenase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00830	Retinol metabolism

Diseases

Associated diseases	References
Retinal dystrophy, juvenile cataracts, and short stature syndrome	KEGG:H02292
Retinal dystrophy, juvenile cataracts, and short stature syndrome	KEGG:H02292
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881