• Gene id: 51094

Gene Summary

• Gene Symbol: ADIPOR1   Gene   UCSC   Ensembl
• Aliases: ACDCR1, CGI-45, CGI45, PAQR1, TESBP1A
• Gene name: adiponectin receptor 1
• Alternate names: adiponectin receptor protein 1, progestin and adipoQ receptor family member 1, progestin and adipoQ receptor family member I,
• Gene location: 1q32.1 (202958571: 202940824)     Exons: 11     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase
• OMIM: 607945

Protein Summary

• Protein general information: Q96A54  
  • Name: Adiponectin receptor protein 1 (Progestin and adipoQ receptor family member 1) (Progestin and adipoQ receptor family member I)
  • Length: 375  
  • Mass: 42616
  • Tissue specificity: Widely expressed (PubMed
• Sequence:

  MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHH
  AMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLF
  LGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLY
  YSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
  GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

• Structural information:
  • Interpro: IPR004254  
  • PDB: 3WXV 5LXG
  • PDBsum: 3WXV 5LXG
  • DIP: 48622
  • STRING: ENSP00000341785
• Other Databases: GeneCards:  ADIPOR1  Malacards:  ADIPOR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0033211	adiponectin-activated signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0055100	adiponectin binding	IDA	molecular function
GO:0033211	adiponectin-activated signaling pathway	IDA	biological process
GO:0097003	adipokinetic hormone receptor activity	IDA	molecular function
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0042593	glucose homeostasis	ISS	biological process
GO:0019216	regulation of lipid metabolic process	ISS	biological process
GO:0010906	regulation of glucose metabolic process	ISS	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0042304	regulation of fatty acid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0042593	glucose homeostasis	IEA	biological process
GO:0055100	adiponectin binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0033210	leptin-mediated signaling pathway	IEA	biological process
GO:0033211	adiponectin-activated signaling pathway	IEA	biological process
GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0010906	regulation of glucose metabolic process	IEA	biological process
GO:0033211	adiponectin-activated signaling pathway	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0010719	negative regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	IMP	biological process
GO:0010633	negative regulation of epithelial cell migration	IMP	biological process
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0019395	fatty acid oxidation	IDA	biological process
GO:0009755	hormone-mediated signaling pathway	IDA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04932	Non-alcoholic fatty liver disease
hsa04152	AMPK signaling pathway
hsa04211	Longevity regulating pathway
hsa04920	Adipocytokine signaling pathway

Diseases

Associated diseases	References
Breast cancer	PMID:18451143
prostate adenocarcinoma	PMID:21397927
macular degeneration	PMID:22387454
obesity	PMID:17391161
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881