• Gene id: 51087

Gene Summary

• Gene Symbol: YBX2   Gene   UCSC   Ensembl
• Aliases: CONTRIN, CSDA3, DBPC, MSY2
• Gene name: Y-box binding protein 2
• Alternate names: Y-box-binding protein 2, DNA-binding protein C, germ cell specific Y-box binding protein,
• Gene location: 17p13.1 (7294556: 7288251)     Exons: 10     NC_000017.11
• Gene summary(Entrez): This gene encodes a nucleic acid binding protein which is highly expressed in germ cells. The encoded protein binds to a Y-box element in the promoters of certain genes but also binds to mRNA transcribed from these genes. Pseudogenes for this gene are loc
• OMIM: 611447

SNPs

rs222859

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.7294475C>A
NC_000017.10   g.7197794C>A
NM_015982.4   c.26G>T
NM_015982.3   c.26G>T
XM_017024713.2   c.26G>T
NP_057066.2   p.Gly9Val
XP_016880202.1   p.Gly9Val|SEQ=[C/A]|GENE=YBX2

Protein Summary

• Protein general information: Q9Y2T7  
  • Name: Y box binding protein 2 (Contrin) (DNA binding protein C) (Dbpc) (Germ cell specific Y box binding protein) (MSY2 homolog)
  • Length: 364  
  • Mass: 38,518
• Sequence:

  MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSG
  TPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVE
  GEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCP
  PPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDG
  ETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE

• Structural information:
  • Protein Domains: CSD. (93-163)
  • Interpro: IPR019844  IPR011129  IPR002059  IPR012340  
  • Prosite: PS00352 PS51857
  • CDD: cd04458
  • STRING: ENSP00000007699
• Other Databases: GeneCards:  YBX2  Malacards:  YBX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0009386	translational attenuation	TAS	biological process
GO:0048599	oocyte development	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0009386	translational attenuation	TAS	biological process
GO:0048599	oocyte development	IEA	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0006366	transcription from RNA polymerase II promoter	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0009386	translational attenuation	TAS	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 18339382
Azoospermia	MIK: 18339382
Spermatogenesis defects	MIK: 18372033
Oligozoospermia	MIK: 18339382
Abnormal protamine expression and male infertility	MIK: 25336347
Azoospermia	MIK: 26804374
Male infertility	MIK: 26804374
Oligozoospermia	MIK: 18339382
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18372033	Spermatogenic impairment, idiopathic infertile men	MSY2 (c.187T>C, allele G of c.1095+16A>G)		536 (326 patients with azoospermia or severe oligospermia, 210 controls)	Male infertility	MSY2
18339382	Azoospermia, severe oligozoospermia, male factor fertility			288 men with complete azoospermia, severe oligozoospermia, and protamine deregulation, or men were of known paternity	Male infertility	YBX2 MSY2
17035640	Leads to speramtogenic arrest, male infertility				Male infertility
26804374	Azoospermia, Male infertility	rs222859		276 (96 men with normal spermatogenesis, 60 men with nonobstructive azoospermia, 60 men with oligospermia and 60 men with asthenospermia)	Male infertility
25336347	Abnormal protamine expression and male infertility				Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray