• Gene id: 51083

Gene Summary

• Gene Symbol: GAL   Gene   UCSC   Ensembl
• Aliases: ETL8, GAL-GMAP, GALN, GLNN, GMAP
• Gene name: galanin and GMAP prepropeptide
• Alternate names: galanin peptides, galanin prepropeptide, galanin-message-associated peptide, galanin-related peptide, galanin/GMAP prepropeptide,
• Gene location: 11q13.2 (68684543: 68691174)     Exons: 6     NC_000011.10
• Gene summary(Entrez): This gene encodes a neuroendocrine peptide that is widely expressed in the central and peripheral nervous systems and also the gastrointestinal tract, pancreas, adrenal gland and urogenital tract. The encoded protein is a precursor that is proteolytically
• OMIM: 608773

Protein Summary

• Protein general information: P22466  
  • Name: Galanin peptides [Cleaved into: Galanin; Galanin message associated peptide (GMAP)]
  • Length: 123  
  • Mass: 13302
• Sequence:

  MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPG
  SFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS

• Structural information:
  • Interpro: IPR008174  IPR008175  IPR013068  
  • Prosite: PS00861
  • STRING: ENSP00000265643
• Other Databases: GeneCards:  GAL  Malacards:  GAL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005184	neuropeptide hormone activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0030141	secretory granule	IBA	cellular component
GO:0031763	galanin receptor binding	IBA	molecular function
GO:0005184	neuropeptide hormone activity	IDA	molecular function
GO:0031766	type 3 galanin receptor binding	IDA	molecular function
GO:0031765	type 2 galanin receptor binding	IDA	molecular function
GO:0031764	type 1 galanin receptor binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004966	galanin receptor activity	IMP	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043627	response to estrogen	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0031943	regulation of glucocorticoid metabolic process	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0050672	negative regulation of lymphocyte proliferation	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0035902	response to immobilization stress	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0051464	positive regulation of cortisol secretion	IDA	biological process
GO:0010737	protein kinase A signaling	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0051795	positive regulation of timing of catagen	IDA	biological process
GO:0019933	cAMP-mediated signaling	IDA	biological process
GO:1902608	positive regulation of large conductance calcium-activated potassium channel activity	IDA	biological process
GO:0043025	neuronal cell body	IDA	cellular component
GO:0030073	insulin secretion	NAS	biological process
GO:0005184	neuropeptide hormone activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Familial epilepsy temporal lobe	KEGG:H00809
Familial epilepsy temporal lobe	KEGG:H00809
type 2 diabetes mellitus	PMID:15735230
type 1 diabetes mellitus	PMID:16060906
obesity	PMID:11220530
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray