• Gene id: 51081

Gene Summary

• Gene Symbol: MRPS7   Gene   UCSC   Ensembl
• Aliases: COXPD34, MRP-S, MRP-S7, RP-S7, RPMS7, S7mt, bMRP27a
• Gene name: mitochondrial ribosomal protein S7
• Alternate names: 28S ribosomal protein S7, mitochondrial, 30S ribosomal protein S7 homolog, bMRP-27a, mitochondrial small ribosomal subunit protein uS7m,
• Gene location: 17q25.1 (156366043: 156385218)     Exons: 16     NC_000001.11
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611974

Protein Summary

• Protein general information: Q9Y2R9  
  • Name: 28S ribosomal protein S7, mitochondrial (MRP S7) (S7mt) (Mitochondrial small ribosomal subunit protein uS7m) (bMRP 27a) (bMRP27a)
  • Length: 242  
  • Mass: 28134
• Sequence:

  MAAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIK
  AAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALK
  NCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHD
  LHKMAEANRALAHYRWW

• Structural information:
  • Interpro: IPR000235  IPR023798  IPR036823  
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000245539
• Other Databases: GeneCards:  MRPS7  Malacards:  MRPS7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000028	ribosomal small subunit assembly	IBA	biological process
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0003729	mRNA binding	IBA	molecular function
GO:0005763	mitochondrial small ribosomal subunit	IBA	cellular component
GO:0005840	ribosome	IBA	cellular component
GO:0006412	translation	IBA	biological process
GO:0019843	rRNA binding	IBA	molecular function
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0006412	translation	IEA	biological process
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0032543	mitochondrial translation	ISS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003735	structural constituent of ribosome	ISS	molecular function
GO:0005763	mitochondrial small ribosomal subunit	ISS	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq