• Gene id: 51077

Gene Summary

• Gene Symbol: FCF1   Gene   UCSC   Ensembl
• Aliases: Bka, C14orf111, CGI-35, UTP24
• Gene name: FCF1 rRNA-processing protein
• Alternate names: rRNA-processing protein FCF1 homolog, FCF1 small subunit,
• Gene location: 14q24.3 (74713117: 74738619)     Exons: 8     NC_000014.9
• OMIM: 0

Protein Summary

• Protein general information: Q9Y324  
  • Name: rRNA processing protein FCF1 homolog
  • Length: 198  
  • Mass: 23370
• Sequence:

  MGKQKKTRKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNF
  INFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVT
  QHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF

• Structural information:
  • Protein Domains: (67..16-)
    (/note="PINc"-)
  • Interpro: IPR006984  IPR029060  IPR002716  
  • STRING: ENSP00000344393
• Other Databases: GeneCards:  FCF1  Malacards:  FCF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0032040	small-subunit processome	IBA	cellular component
GO:0032040	small-subunit processome	IEA	cellular component
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006364	rRNA processing	IEA	biological process
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA	biological process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881